(data stored in ACNUC30630 zone)

EMBL: AP010890.PE513

AP010890.PE513       Location/Qualifiers
FT   CDS_pept        669339..669557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0516"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0516"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70660"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSB6"
FT                   /protein_id="BAJ70660.1"
FT                   /translation="MTLQETRAYDDIINLPHHQSRKHPHMSRHQRAAQFMPFAALTGYN
FT                   QVIEQTAKNAETAIAQAEAQGDTDFGA"
     atgaccctgc aagagacccg tgcgtacgac gacatcatca acctgccaca ccatcagtcg        60
     cgcaagcatc cgcacatgtc ccgccaccag cgggccgcgc agttcatgcc gttcgcggcc       120
     ctgaccggct acaaccaagt catcgagcaa acagcaaaaa acgccgaaac cgccatcgct       180
     caggccgaag cccaaggcga taccgatttc ggcgcttga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page