(data stored in ACNUC30630 zone)

EMBL: AP010890.PE524

AP010890.PE524       Location/Qualifiers
FT   CDS_pept        complement(684582..685607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70671"
FT                   /db_xref="GOA:E8MSC7"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSC7"
FT                   /protein_id="BAJ70671.1"
FT                   /translation="MLSFENDYSRAAHPAVLEAVAEANNHLYSGYGSDELSDQAKAKIR
FT                   EACGQPDADVWFLVGGTQTNQVVIDTITPAYAGVVAVASGHPNVHEAGAIEFSGHKVLT
FT                   IPQHNGKMDPTELDEFCKTFYADGNYEHMVFPGSVYVSQSTEYGTIYSKAELQAIADVA
FT                   HKYDMPLFVDGARLGYALTATGSDMTLADLATIADVFYIGGTKVGALFGEAVVFTKHNT
FT                   PKHFLTLIKQHGALLAKGFVLGAQFDALFTDNLYFKIARNANEAADRIREALRAKGYTL
FT                   TFEAPTNQIFVTMDQPTIDRLEREVKLGFTEKADDTHTVMRICTSWATTHEEVDQLIEL
FT                   L"
     atgctgtctt ttgagaacga ttactcccgc gccgcccatc ccgcggtgct tgaagccgtg        60
     gctgaagcca acaaccatct gtattcgggc tacgggtccg acgaactgag cgatcaggcc       120
     aaggccaaga tccgcgaggc ctgcggccag ccggacgcgg atgtgtggtt cctcgtcggc       180
     ggcacgcaga ccaaccaggt cgtcatcgac accatcaccc cggcgtatgc aggcgtggtc       240
     gcggtcgcct ccggccatcc gaacgtgcac gaggccggcg ccatcgagtt ctccgggcac       300
     aaggtgctca cgattcccca gcacaacggc aaaatggacc cgaccgaact ggacgagttc       360
     tgcaagacct tctatgcgga cggcaactac gagcacatgg tgttcccggg ctccgtgtac       420
     gtctcgcaaa gcaccgaata tggcaccatc tactccaagg ccgagttgca ggccatcgcc       480
     gatgtggcgc acaagtacga catgccgctg ttcgtggatg gcgcgcgact cggctacgcg       540
     ctgaccgcca ccggttcaga catgacgctc gcggatctgg cgaccatcgc cgacgtgttc       600
     tacatcggcg gtaccaaggt gggtgccctg ttcggcgagg ccgtggtgtt taccaagcac       660
     aacacgccga agcacttctt gaccctcatc aagcagcacg gtgccttgct ggccaagggc       720
     tttgtgctgg gcgcgcagtt tgacgctttg ttcaccgaca acctgtattt caagatcgcc       780
     cgcaacgcca atgaggcggc cgatcgtatt cgcgaggccc tgcgcgccaa gggctacacg       840
     ctcactttcg aagcgcccac caaccagatt ttcgtgacga tggatcagcc gaccatcgac       900
     cgtctggagc gcgaggtcaa gctcggcttt accgagaagg ccgacgacac gcataccgtg       960
     atgcgcatct gcaccagctg ggccaccacg catgaagagg tcgatcagct tattgagttg      1020
     ttgtaa                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page