(data stored in ACNUC30630 zone)

EMBL: AP010890.PE535

AP010890.PE535       Location/Qualifiers
FT   CDS_pept        complement(697281..697649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0539"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0539"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70682"
FT                   /db_xref="GOA:E8MSD8"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSD8"
FT                   /protein_id="BAJ70682.1"
FT                   /translation="MMTVFLPILVCLCGGVGASCRYLLDVTIKTYWQRAFPLSTFTINL
FT                   IAGFLAGLVAALALGGTLDEPWRLVLATGFLGGFSTFSTAINEMVTLFRKHRYPTAAAY
FT                   LVLSLGVPVVAAACGFLV"
     gtgatgaccg tattcctacc aatcttggtc tgcctgtgcg gcggcgtagg cgcctcctgc        60
     cgctatctgc ttgacgtgac catcaaaacg tactggcagc gcgcattccc actttccacg       120
     ttcaccatca atctcatcgc cggattccta gccggtttgg tcgcggcgct ggcactcggc       180
     gggacacttg atgaaccatg gcggctagtg ctggccaccg gtttcctcgg cggcttctcc       240
     acgttctcga ccgcaatcaa cgaaatggtg acgctcttcc gcaaacaccg ctaccccacc       300
     gcagcggcct atctggtgct gtcgctgggt gtgccggtcg ttgctgcggc ctgcggtttt       360
     ctcgtctga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page