(data stored in ACNUC30630 zone)

EMBL: AP010890.PE543

AP010890.PE543       Location/Qualifiers
FT   CDS_pept        704768..706525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0547"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70690"
FT                   /db_xref="InterPro:IPR025101"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSE6"
FT                   /protein_id="BAJ70690.1"
FT                   /translation="MPSHARTVTRTTHRVRNALLVVLLLLVVCAAAAGFSGFKLYKSAM
FT                   SAKAHLNNVVNAAKVIKDGSTDDMVKALSDVSYIQKEAAAAKQDVSGGLWTLAEKMPVV
FT                   GGDVKTARTAIGTIDDFAQTTLPQLGKVVTTLTGASLSSGDGQLNMEPIIAAAQQLATV
FT                   DQSVQSQARTIQDLPDAKLGVVNNALQNGKTQMAALAQVTENLSGMLNMLPNFLGANGA
FT                   RNYVLLAQTNSEIRGTGGLIGSAGSFSADNGKIAVGEFHADAEFPSNAALDDVNQDGDG
FT                   TLYSGLYFGQVIHNLSSTPDFPRVASMAQKFWQAAPFGGSSDGVMSLDPVALQAMIGAT
FT                   GDVTLSDGRVLNGSNTAEFLLNGAYKELTPSAQDQYFSETAAQAVAHLFSDMNTQKLMT
FT                   VAKTMLRMAEQRHLYFWSFHEEDQAVLRSAGVTGEITNDAKNPVTGVYSNEMQASKMDW
FT                   YIQRKSTVKRTGDNTYHVTYSFTNTLQPGEAGSLPEYITANAKGGVAVNRVVIYTPAGG
FT                   EVSNVSASNGSSFAQVQAKDHMTYMDDISLAPQDTVTIEYDVTTAAGSANLKLDQTPTI
FT                   GDPAITYEY"
     atgccatcac acgcacgcac ggtcaccagg acaacccatc gcgttcgcaa cgcgctgctc        60
     gtcgtactgc tgttgctggt cgtgtgcgcc gcggcggccg gcttcagcgg attcaaactg       120
     tacaagtcgg cgatgagcgc caaagcgcac ctcaacaatg tcgttaacgc ggccaaggtc       180
     atcaaggacg gttccaccga cgacatggtc aaggcgctgt ccgacgtgag ctacatccag       240
     aaggaggcgg ccgccgccaa gcaggatgtc agcggcggtc tgtggacgct ggcggagaag       300
     atgcccgtgg tcggcggtga cgtgaagacg gcgcgcaccg ccatcggtac catcgatgac       360
     ttcgcgcaga ccacgctgcc ccagctgggc aaggtcgtca ccacactgac cggtgccagc       420
     ctctccagtg gcgatgggca gctcaacatg gagccgatca tcgctgcggc gcagcagctt       480
     gccacggtcg accagtccgt gcaatcacag gccaggacga tccaggatct tcccgacgcc       540
     aaactcggcg tggtgaacaa cgcgctgcag aacggcaaga cgcagatggc tgccctggcg       600
     caggtgaccg aaaacctgag cggcatgctc aacatgctgc cgaacttcct cggtgcgaac       660
     ggcgcccgca actacgtgct gcttgcccag acgaattccg agatccgcgg aaccggcggc       720
     ctgatcggtt cggccggttc cttcagcgcg gacaacggca agatcgcggt gggggagttc       780
     cacgcggatg ccgagttccc ctccaacgcc gcgttggatg acgtcaacca ggacggtgac       840
     ggcacgctgt acagcggact gtacttcggt caagtcattc ataatctttc gtccacgccg       900
     gacttcccgc gcgtcgcgtc catggcccag aagttctggc aggcggctcc gttcggcgga       960
     tcgtccgacg gcgtgatgtc gctcgacccc gtcgcgctgc aggcgatgat cggcgccacc      1020
     ggcgacgtga ctctgtccga cgggcgcgtg ctcaacgggt cgaacaccgc cgaattcctg      1080
     ctcaacggcg cctacaagga actgacgccc tccgctcagg accagtactt cagcgagacc      1140
     gccgcccagg cggtcgccca cctgttcagc gacatgaaca cgcagaagct catgaccgtc      1200
     gccaagacga tgctccggat ggccgagcag cggcacctgt acttctggtc gttccacgag      1260
     gaggatcagg cggtgctgcg cagcgccggc gtcaccggcg agatcaccaa cgacgcgaag      1320
     aacccggtga ccggcgtcta ctccaacgag atgcaggcct cgaagatgga ctggtacatc      1380
     cagcgcaagt cgacggtgaa gaggaccggc gacaacacct accacgttac gtattcgttc      1440
     accaacaccc tgcagccggg cgaggccgga tccctgccgg aatacatcac ggcgaacgcc      1500
     aagggaggcg tggcggtgaa ccgcgtggtc atctacacgc cggccggagg cgaggtcagc      1560
     aacgtgtcgg cgtcgaacgg cagttccttc gcacaggtgc aggccaagga ccatatgacc      1620
     tacatggacg acatctccct ggcgcctcag gacacggtga ccatcgaata cgacgtgacc      1680
     accgcggccg gctcggccaa cctcaaactg gatcagacgc cgaccatcgg cgaccccgcg      1740
     atcacgtacg agtattga                                                    1758
//

If you have problems or comments...

PBIL Back to PBIL home page