(data stored in ACNUC30630 zone)

EMBL: AP010890.PE587

AP010890.PE587       Location/Qualifiers
FT   CDS_pept        complement(750177..750851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0591"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70734"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSJ0"
FT                   /protein_id="BAJ70734.1"
FT                   /translation="MGKHTQNCTLIGKGVYGTIGVDQRSRLADGAHFHTMIVTSTLEAS
FT                   VIEGDKLVIKSGIVRCDGDIRVSSISGSGDIEVGGDIICDEITFTGKLRCNGDIVCSGN
FT                   LSVNGSLGTRHISGQTVRLNGVLKGHDVNSRALEVHPLRSTMFSRFDMDGYEDGSTVRH
FT                   ITAVTVEANHLQCRTLTADSAMLRNGSAVESATCATALGIDRTSSVLLVNGDCQRIHLK
FT                   TA"
     atgggcaagc atacgcagaa ttgcacgctg ataggcaaag gagtctacgg caccatagga        60
     gtggaccaac gttcccgtct tgccgatggc gcgcattttc acaccatgat tgtgaccagc       120
     accctcgagg cctcagttat agaaggggac aaactggtca tcaaaagtgg cattgtgcgg       180
     tgtgatggtg atattcgcgt atccagcatc agcggcagcg gcgacatcga agtcggcggc       240
     gacattattt gcgatgaaat aacctttacc ggcaaactac gatgcaacgg cgatatcgtt       300
     tgttccggaa atctgtccgt caatggctcc ctaggcaccc gtcatattag cggtcagaca       360
     gtccgcttga acggcgtgtt gaagggtcat gacgtcaaca gcagggctct ggaagttcat       420
     ccactccgca gtacgatgtt ttcccgtttt gatatggatg ggtatgagga tggcagcacg       480
     gttcgccata tcacagccgt cacggttgaa gccaaccatc tgcaatgccg gactttgacg       540
     gcggactccg ccatgctacg caacggcagt gcggtggaaa gcgccacgtg tgccaccgca       600
     ctaggcatcg accgtacctc cagcgtgctg ctggtgaacg gagactgcca acgcattcat       660
     ctcaagacag cgtaa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page