(data stored in ACNUC30630 zone)

EMBL: AP010890.PE627

AP010890.PE627       Location/Qualifiers
FT   CDS_pept        complement(799584..799946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0631"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70774"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSN0"
FT                   /protein_id="BAJ70774.1"
FT                   /translation="MFGTRLPRYRTRTGMFDDMVAAQVRRLGQAWPELIRPLQFAVEDV
FT                   PPSDPTPWQTEPNMTSQCFPASHGIPARVVLYRMPLQTEAPTKLELQLAVRDELVARIA
FT                   ELYGRRPEEIDPDWGL"
     atgttcggca cccgtctgcc ccgttaccgc actcgcaccg gcatgttcga cgatatggtg        60
     gcggcccagg ttcgcaggct cggccaagcg tggccggaac tgatacgtcc gctccagttc       120
     gcggtggagg atgtgccgcc ttcggatccg acgccttggc agaccgagcc gaatatgacg       180
     tcccagtgct tccccgccag ccacggcatt cccgcacgag tcgtgctcta ccgcatgccg       240
     ttgcagaccg aggcacctac caagctcgaa ctgcaattgg ccgtcaggga tgagctggtg       300
     gcccgcatag cggaattgta tgggcgcagg cccgaggaaa tcgaccccga ctggggcctg       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page