(data stored in ACNUC30630 zone)

EMBL: AP010890.PE631

AP010890.PE631       Location/Qualifiers
FT   CDS_pept        complement(802009..803085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0635"
FT                   /product="two-component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0635"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70778"
FT                   /db_xref="GOA:E8MSN4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSN4"
FT                   /protein_id="BAJ70778.1"
FT                   /translation="MMASKKQQQSRLDAMKPRVKPVDLFSSLKLELSALIVIATAIAFA
FT                   MCWFLLKFGWSGWIAMPLTLVVALGITYFFSRGITAPLRQMRDVAEAMADGDYTVRVDI
FT                   DQDRHDEVGKLARSFNEMAGELEHADKMRRDMIANVSHELRTPVSALQAMVENMADGVT
FT                   EPTPTNLESILTQTQRLSDLIAFLLDLSRMEAGAASLNIEKFNFADFLDETIEPLEIAD
FT                   GGHAHDIRVTVPADITMEGDQDRLRQLFTNIIANALKHSADGTTVLVDAHEDENQGTIV
FT                   TNVVNFGSQIAPSDRLDIFRRFVKGKTGPGTESGGTGLGLSIAHWAAQLHGGTVKVVDD
FT                   TRGADFEIILPKYHIAER"
     gtgatggcat ccaaaaaaca acagcaatcc cggcttgatg cgatgaaacc tcgcgtcaag        60
     ccggttgatt tgttctcatc tctgaagctg gaactcagcg cactgatcgt tatcgccact       120
     gccatcgcgt ttgccatgtg ctggttcctc ctgaaattcg gctggtccgg ttggatcgcc       180
     atgccgctga ctttggtggt ggccttgggc atcacctatt tcttctctcg cggcatcacc       240
     gctcccctac gccagatgcg cgatgtggcc gaagccatgg cggatggcga ttacacggtc       300
     cgcgtggata tcgatcagga tcgtcatgac gaggtcggca agctggctcg ctcgttcaac       360
     gagatggccg gcgaactcga gcatgccgat aaaatgcgcc gcgacatgat cgccaatgtg       420
     agccatgagc tgcgcacgcc cgtttccgct ttgcaggcga tggtcgagaa catggccgac       480
     ggcgtcaccg agcccactcc caccaatctg gagagcatcc tcacccaaac gcagcgtctc       540
     tccgatctca tcgccttcct actggacctg agccgtatgg aggccggtgc ggcgagtctg       600
     aatatcgaaa agttcaactt cgccgacttt cttgacgaga ccatcgagcc gttggaaatc       660
     gccgatggtg gccacgccca cgacatccgc gtcaccgtgc cggccgacat cacgatggaa       720
     ggcgatcagg accgcctgcg ccagctattc accaacatca tcgccaacgc gctgaaacat       780
     tcggccgacg gcaccaccgt gctggtcgac gcccacgagg acgaaaacca aggcaccatc       840
     gtgaccaatg tggtgaattt cggctcccag attgcgcctt ccgaccgttt ggacatcttc       900
     cggcgctttg tcaaaggcaa gacgggtccc ggcaccgagt cgggcggcac cggtcttggc       960
     ctgtccatcg cgcactgggc ggcccaattg cacggtggca ccgtcaaagt ggtcgacgac      1020
     acgcgaggtg ccgatttcga aatcatcctg cctaaatatc acatcgccga acgctga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page