(data stored in ACNUC30630 zone)

EMBL: AP010890.PE641

AP010890.PE641       Location/Qualifiers
FT   CDS_pept        813455..814072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0645"
FT                   /product="dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0645"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70788"
FT                   /db_xref="GOA:E8MSP4"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSP4"
FT                   /protein_id="BAJ70788.1"
FT                   /translation="MGTMMRIGLTGGIAAGKSTVAARLKQLGALHIDYDALAHQIVEPG
FT                   GVALPQIVAEFGPDALLADGTMNRPWIADHVFGANAAPGARERLDAIEHPLIYAEAARL
FT                   EHEHPEAAIIIHDIPLLAEVIDDIPFAFDHIVTVEAPVCMRLDRMVEERGMSLEQAEAR
FT                   IRHQSSEEERRAIADIVIDSTHPLPEMLAQVGEIYAGWCAGR"
     atgggcacca tgatgcgaat aggactgacc ggcggcatcg ccgcgggcaa aagtacggtg        60
     gcggcgcgac tcaagcaact cggcgcgttg catatcgact acgatgcgct ggcgcatcag       120
     atcgtcgaac ccgggggagt ggcgctgcca cagatcgtcg ccgagttcgg tcctgatgca       180
     ttgctcgccg atggcactat gaaccggcca tggattgccg atcatgtctt cggcgcgaac       240
     gccgcgccgg gcgcacgtga acggctcgac gccatcgagc acccattgat ctatgccgag       300
     gcggcgcgac tggagcatga gcaccccgag gcagccatca tcattcacga cattccactg       360
     ctcgccgagg tcattgacga tattccattc gcctttgacc atatcgtcac ggtcgaagct       420
     cccgtgtgca tgcggctcga ccgtatggtc gaggaacgcg gcatgagcct ggaacaggcc       480
     gaggcccgca tccgccacca atccagtgag gaggagcggc gggccatagc cgatatcgtc       540
     atcgactcca cccatccatt gcccgagatg ctggcccaag tgggtgagat atacgcagga       600
     tggtgcgcag gtcgctaa                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page