(data stored in ACNUC30630 zone)

EMBL: AP010890.PE649

AP010890.PE649       Location/Qualifiers
FT   CDS_pept        824887..825561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0653"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0653"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70796"
FT                   /db_xref="GOA:E8MSQ2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSQ2"
FT                   /protein_id="BAJ70796.1"
FT                   /translation="MFGGSKQEQLEHRLDHKLNASSDGIDMDVPAKVISSETVYTGRIF
FT                   HVDDMRIALTDKQGKEHEIGRQVLRHAPCVVMLVHDMSTDRYLIEREYRAGSDMFAYGL
FT                   PAGLMDEGEDIMDAALRELAEETGVVPDRDTMGVDFVGDFYSSEGMTDELAHIMVLHLG
FT                   PFRREQRHFDADEHVESAWIPWSDLAATRITSSNSMIAIQHEALRRLIARNSDKDKPSL
FT                   FS"
     atgtttggcg gaagcaagca ggaacaactg gagcatcggc tcgaccataa gctgaacgcc        60
     tcctcggacg gcatcgacat ggacgtgccc gccaaagtga tcagtagcga aaccgtttat       120
     accgggcgta tcttccatgt ggacgacatg cgcatcgctc tgaccgacaa gcagggcaag       180
     gaacacgaga tcggccgcca ggtgctgcgt cacgccccct gtgtggtcat gctcgtgcac       240
     gacatgtcca ccgaccgcta cctcatcgaa cgcgaatacc gcgccggatc ggacatgttc       300
     gcctacgggc ttcccgccgg actgatggac gagggcgagg acatcatgga cgcggccctg       360
     agggaactgg ccgaggaaac cggcgtggtg ccggaccgtg acaccatggg cgttgacttc       420
     gtaggtgatt tctactcgtc cgaaggcatg accgacgaac tggcccacat catggtgttg       480
     catttgggcc cgttcaggcg ggagcagcgc catttcgatg cggacgagca tgtggaatcc       540
     gcgtggattc cgtggagcga ccttgccgcc acgcgcatca cctcatccaa ttcgatgatc       600
     gccatccagc atgaggcgtt acgcagactc atcgccagga actccgacaa agataagccg       660
     tcgctgttct cctga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page