(data stored in ACNUC30630 zone)

EMBL: AP010890.PE653

AP010890.PE653       Location/Qualifiers
FT   CDS_pept        828732..829382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0657"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0657"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70800"
FT                   /db_xref="InterPro:IPR008319"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSQ6"
FT                   /protein_id="BAJ70800.1"
FT                   /translation="MAFDYKKEYKDLYQPKRMPAIVTVPAMRFVAVDGVGDPNEEGGDY
FT                   AKAMQLLYGISFTIKMNKKSNNPDEHIDGYFDYTVPPLEGLWSMEKGVPGVDYTRKTDF
FT                   YWTSMIRLPEFVTDEVFAWAKASFASKHPEVDINRAYLFDFDEGVVAQVMHKGPYDDEP
FT                   ATVTILDGYARSQGYGLDFSDARRHHEIYLSDPRRAKPENLKTIIRHPVVKVG"
     atggcattcg actataaaaa ggaatataag gacctgtatc agccgaagag gatgcccgcc        60
     atcgtcacgg tgccggcgat gcggttcgtc gcggtggacg gtgtaggaga tccgaacgaa       120
     gaaggcggcg actacgccaa ggcgatgcaa ctgctgtacg gcatttcgtt caccatcaaa       180
     atgaacaaga agtcaaataa tccggacgag cacattgacg ggtacttcga ctacaccgtg       240
     cctccgctgg agggcttatg gagcatggag aagggtgtgc ccggcgtcga ttacacgcgt       300
     aaaaccgact tctattggac ttcgatgatt cgtctgccgg aattcgtgac cgatgaggtc       360
     tttgcgtggg ccaaggcatc gtttgcctcc aagcatcccg aagtcgacat caatcgtgca       420
     tatctcttcg acttcgatga aggcgtggtc gcgcaggtca tgcacaaagg cccgtacgac       480
     gacgagcccg caaccgtgac gattctggac ggctacgcgc gttcgcaagg ctacgggctc       540
     gacttctccg acgcccgccg ccatcacgag atctacctat ccgacccgcg ccgagccaaa       600
     ccggaaaatc tcaaaaccat catccgtcat ccggtagtga aggtgggttg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page