(data stored in ACNUC30630 zone)

EMBL: AP010890.PE668

AP010890.PE668       Location/Qualifiers
FT   CDS_pept        851560..852072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0672"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70815"
FT                   /db_xref="GOA:E8MSS1"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSS1"
FT                   /protein_id="BAJ70815.1"
FT                   /translation="MGNPIRHREQLLPRNVEQGFAWLPKTRWSKRCRRRVRSKSMHGWL
FT                   CGDFPDRSLLGEIFLFPGLLSGVSVFCHVGVVVINFELAVGMENKRHRSPSLFGLKRGP
FT                   FRFNELVDSHKVFHQGCPRNAFLVKAFNEVVFSAASNVILNRERTLGVLGVKHDLAPVF
FT                   GEGFLKN"
     atggggaatc ccattcgtca tagagagcaa ttactcccga ggaatgttga acaggggttt        60
     gcatggctcc caaaaacgcg ctggtcgaaa cgttgccgac gacgcgtgcg ctcgaagagt       120
     atgcacgggt ggctttgcgg tgatttccca gaccgttcgt tgctaggcga gatatttctt       180
     tttccaggcc ttctttcggg cgtaagcgtt ttctgtcatg tcggagtagt cgtaatcaac       240
     tttgaacttg ccgttggaat ggagaataag cgtcatcgat ccccatctct tttcgggctt       300
     aagcgcggcc ctttcaggtt caatgaactt gttgatagcc ataaagtttt tcatcaagga       360
     tgccctcgaa acgccttttt ggtcaaagca tttaacgaag tcgtcttttc cgctgccagc       420
     aacgtaatac tcaatagaga acgcaccctc ggcgtactcg gcgtaaaaca cgaccttgct       480
     ccagtcttcg gggagggttt cctcaagaat tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page