(data stored in ACNUC30630 zone)

EMBL: AP010890.PE682

AP010890.PE682       Location/Qualifiers
FT   CDS_pept        complement(862839..863189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0686"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0686"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70829"
FT                   /db_xref="GOA:E8MST5"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="UniProtKB/TrEMBL:E8MST5"
FT                   /protein_id="BAJ70829.1"
FT                   /translation="MFDSVTTIGLLLTLVMIFSFQGNTILEKPLHIVLIAVPLILQTFL
FT                   IFAIAYIACRVLKLPYKIAAPAGMICASNFFELAVAVAIALFGTTSPAALATTVGVLTE
FT                   VPVMLFLVKKRK"
     atgtttgaca gtgtaactac cattggctta ttgctgacgc tggtgatgat tttctcgttc        60
     caaggcaata ccattctgga aaaacctctg cacattgttt tgattgcggt accgctgatt       120
     ttacagacct tcctgatttt tgcgattgcg tatatcgctt gccgggtttt gaagctgccc       180
     tacaagattg ctgctcccgc cggaatgatt tgtgcttcca acttctttga actggctgtt       240
     gctgttgcaa tcgccttgtt tggaacgact tcccctgcgg cactggcaac gactgtgggt       300
     gtgctgacag aagttcccgt gatgctgttc cttgtaaaaa aacgcaaata a                351
//

If you have problems or comments...

PBIL Back to PBIL home page