(data stored in ACNUC30630 zone)

EMBL: AP010890.PE694

AP010890.PE694       Location/Qualifiers
FT   CDS_pept        879629..880216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0698"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0698"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70841"
FT                   /db_xref="InterPro:IPR021555"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSU7"
FT                   /protein_id="BAJ70841.1"
FT                   /translation="MRPQGVPDEVWAAVESVSTMKRIHDVRYREIPVPSTLADYGIGVE
FT                   FEAGERALGDAFSAGLGSDAESRIATGWIMMLYAHELRIDWDSNWRCVAFARLPLETAE
FT                   NDSLTPGMYWDDMCDYFDGIEPDSVSGTVTVTQNTAFGSMAGSTSAGCEIRVSWTPLDG
FT                   TGPDGTMDAGAQVRSWAAFIRSTIRFEEDDAS"
     gtgcgccctc agggtgtgcc ggatgaagta tgggcagccg tcgaatccgt cagcaccatg        60
     aagcgcatcc atgacgtgcg ctatcgggag attcccgtgc cttccacctt ggccgattat       120
     ggtatcggcg tggaattcga agcgggagag cgtgccctcg gcgatgcctt ttccgccggt       180
     cttggcagcg atgccgaatc acgaatcgcc acaggctgga tcatgatgct ttatgctcat       240
     gagctgcgca ttgactggga ttccaactgg cgttgcgtgg cgttcgcgcg actgccgctg       300
     gaaaccgccg aaaacgattc tctgaccccc ggcatgtact gggatgacat gtgcgactat       360
     ttcgacggca tcgagccgga ttcggtatcc ggcacagtca ccgtgaccca aaacacggct       420
     tttggctcga tggccggctc caccagcgcc gggtgtgaga ttcgcgtctc atggaccccg       480
     cttgacggga ccgggccgga cggtactatg gacgccggcg cacaagtccg ctcgtgggcc       540
     gcattcatca gatccaccat ccgttttgag gaggatgacg ccagttga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page