(data stored in ACNUC30630 zone)

EMBL: AP010890.PE72

AP010890.PE72        Location/Qualifiers
FT   CDS_pept        complement(89764..90000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0072"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70219"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWR6"
FT                   /protein_id="BAJ70219.1"
FT                   /translation="MNRDETNEVSGVTDDQLGRTAEPYESGNWRGGVGSIIRSNPKSGT
FT                   DTSRTQQTRIIRVHRLGDVFRNRTTEYHTTEEL"
     atgaaccgag acgaaaccaa cgaagtatct ggagtcaccg acgaccagct cggccgaacg        60
     gccgagccgt acgaatccgg caactggcgg ggcggcgtcg ggagcatcat tcgcagcaat       120
     ccgaaatcag gaaccgacac aagtcggacc cagcagacac gcataatacg agttcacaga       180
     ctcggcgatg tattccgcaa ccgcaccacc gaataccaca ccacggaaga actgtaa          237
//

If you have problems or comments...

PBIL Back to PBIL home page