(data stored in ACNUC10821 zone)

EMBL: AP010958.CITF

AP010958.CITF        Location/Qualifiers
FT   CDS_pept        complement(685715..687247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citF"
FT                   /locus_tag="ECO103_0623"
FT                   /product="citrate lyase citrate-ACP transferase subunit"
FT                   /note="alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0623"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29486"
FT                   /db_xref="GOA:C8U2X8"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2X8"
FT                   /protein_id="BAI29486.1"
FT                   /translation="MTQKIEQSQRQERVAAWNRRAECDLAAFQNSPKQTYQAEKARDRK
FT                   LCANLEEAIRRSGLQDGMTVSFHHAFRGGDLTVNMVMDVIAKMGFKNLTLASSSLSDCH
FT                   APLVEHIRQGVVTRIYTSGLRGPLAEEISRGLLAEPVQIHSHGGRVHLVQSGELNIDVA
FT                   FLGVPSCDEFGNANGYTGKACCGSLGYAMVDADNAKQVVMLTEELLPYPHNPASIEQDQ
FT                   VDLIVKVDRVGDAAKIGAGATRMTTNPRELLIARSAADVIVNSGYFKEGFSMQTGTGGA
FT                   SLAVTRFLEDKMRSRDIRADFALGGITATMVDLHEKGLIRKLLDVQSFDSHAAQSLARN
FT                   PNHIEISANQYANWGSKGASVDRLDVVVLSALEIDTQFNVNVLTGSDGVLRGASGGHCD
FT                   TAIASALSIIVAPLVRGRIPTLVDNVLTCITPGSSVDILVTDHGIAVNPARPELAERLQ
FT                   EAGIKVVSIEWLRERARLLTGEPQPIEFTDRVVAVVRYRDGSVIDVVHQVKE"
     atgacgcaga aaattgaaca atctcaacga caagaacggg tagcggcctg gaatcgtcgc        60
     gctgaatgcg atcttgccgc tttccagaac tcgccaaagc aaacctacca ggctgaaaaa       120
     gcgcgcgatc gcaaactgtg cgccaacctg gaagaagcga ttcgtcgctc tggtttacag       180
     gacggcatga cggtttcctt ccatcacgct ttccgtggcg gtgacctgac cgtcaatatg       240
     gtgatggacg tcatcgcgaa gatgggcttt aaaaacctga ccctggcgtc cagctccctg       300
     agtgattgcc atgcgccgtt ggtagaacac attcgccagg gcgtggttac ccgcatttat       360
     acctccggcc tgcgcggtcc actggcggaa gaaatctccc gcggtctgct ggcggaaccg       420
     gtgcagatcc actctcacgg cggtcgtgtg catctggtac agagcggcga actgaatatc       480
     gacgtggctt tcctcggcgt cccgtcctgt gatgaattcg gtaatgccaa cggctacacc       540
     ggtaaagcct gctgcggctc cctcggctat gcaatggttg atgccgacaa cgcaaaacag       600
     gttgtgatgc ttaccgaaga actgctgcct tatccgcata atccggcaag cattgagcaa       660
     gatcaggttg atttaatcgt caaagttgat cgcgttggcg atgctgcaaa aatcggcgct       720
     ggtgctaccc gtatgaccac taacccgcgc gaactgctta ttgcccgtag cgctgcggat       780
     gtgattgtca actcaggcta cttcaaagaa ggtttctcca tgcaaaccgg caccggcggc       840
     gcatcgctgg cggtaacccg tttcctggaa gacaaaatgc gtagccgcga tattcgcgcc       900
     gacttcgccc tcggtggtat taccgcgacg atggttgatc tgcacgaaaa aggtctgatc       960
     cgcaaactgc tggatgtaca gagctttgac agccacgctg cgcaatcgct ggcccgtaac      1020
     cccaatcaca tcgaaatcag cgccaaccag tacgctaact ggggttcgaa aggtgcatcg      1080
     gttgatcgtc tcgacgtggt ggtactgagc gcgctggaaa ttgacaccca gttcaacgtt      1140
     aacgtgctga ccggctctga cggcgtactg cgtggtgctt ccggtggtca ctgcgatacc      1200
     gcgattgcct ctgcgctttc catcatcgtc gcgccgctgg tacgcggtcg tattccgact      1260
     ctggtggata acgtgctgac ctgcatcacc ccgggctcca gtgtcgatat tctggtcaca      1320
     gaccacggta tcgcagttaa cccggcacgt ccggagctgg cagaacgtct gcaggaagcg      1380
     ggcattaaag tggtttccat tgagtggctg cgtgaacgtg cgcgtctgct gaccggtgaa      1440
     ccacagccga ttgaattcac cgaccgcgtc gttgccgttg tgcgttaccg cgatggctcg      1500
     gtgatcgatg ttgtacatca ggtgaaggaa taa                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page