(data stored in ACNUC10821 zone)

EMBL: AP010958.CLCA

AP010958.CLCA        Location/Qualifiers
FT   CDS_pept        176382..177803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clcA"
FT                   /locus_tag="ECO103_0155"
FT                   /product="chloride channel protein ClcA, voltage-gated"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0155"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29033"
FT                   /db_xref="GOA:C8U1M5"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1M5"
FT                   /protein_id="BAI29033.1"
FT                   /translation="MKTDTPSLETPQAARLRRRQLIRQLLERDKTPLAILFMAAVVGTL
FT                   VGLAAVAFDKGVAWLQNQRMGALVHTADNYPLLLTVAFLCSAVLAMFGYFLVRKYAPEA
FT                   GGSGIPEIEGALEDQRPVRWWRVLPVKFFGGLGTLGGGMVLGREGPTVQIGGNIGRMVL
FT                   DIFRLKGDEARHTLLATGAAAGLAAAFNAPLAGILFIIEEMRPQFRYTLISIKAVFIGV
FT                   IMSTIMYRIFNHEVALIDVGKLSDAPLNTLWLYLILGIIFGIFGPIFNKWVLGMQDLLH
FT                   RVHGGNITKWVLMGGAIGGLCGLLGFVAPATSGGGFNLIPIATAGNFSMGMLVFIFVAR
FT                   VITTLLCFSSGAPGGIFAPMLALGTVLGTAFGMVAVELFPQYHLEAGTFAIAGMGALLA
FT                   ASIRAPLTGIILVLEMTDNYQLILPMIITGLGATLLAQFTGGKPLYSAILARTLAKQEA
FT                   EQLARSKAASASENT"
     atgaaaactg atactccctc tttagaaaca ccgcaggccg cgcgcctgcg acgtagacaa        60
     ctgattcgcc aacttcttga gcgcgataaa accccgttag ccattttgtt tatggcggca       120
     gtcgtcggca cgcttgtcgg gctggcagcg gttgcttttg acaaaggtgt cgcctggttg       180
     cagaaccaac gtatgggggc gctggtacat actgctgata attatccgct actgttaacc       240
     gtcgcttttc tctgttcggc ggtgctggcg atgttcggct actttttggt gcgcaaatac       300
     gcgcccgaag cagggggatc ggggatcccg gaaattgaag gggcgctgga agatcaacgt       360
     cctgttcgct ggtggcgtgt attgccggtg aaattctttg gcgggctggg gacactcggc       420
     ggaggcatgg tgctagggcg cgaaggacca accgtgcaga tcggcggcaa tatcggtcgc       480
     atggtgcttg atattttccg cctgaaaggt gatgaagctc gccatacgct gctggcaacc       540
     ggtgctgctg cggggctggc tgcggccttt aacgcgccgc tggcgggtat tttgtttatt       600
     atcgaagaga tgcgtccgca gtttcgctat acgttaattt cgattaaagc ggtatttatt       660
     ggcgtcatta tgtcgaccat tatgtaccgg atttttaatc atgaagttgc gttgattgac       720
     gtcggtaaac tttctgatgc gccgcttaat acgctgtggc tttatctgat cctcggtatt       780
     atttttggca ttttcggccc tatttttaat aaatgggtgc tggggatgca ggatttgctg       840
     caccgtgtgc acggcggcaa tattaccaaa tgggtactga tgggtggtgc gattggcggt       900
     ctgtgtggat tgctggggtt tgtggcacca gcaacgtcgg gcggcggttt taacctgatt       960
     cctatcgcta ccgcggggaa tttcagcatg ggaatgctgg tgtttatctt cgtcgctcgg      1020
     gtcattacca ccttactctg cttctcttcc ggcgcgccgg gcggtatttt tgccccgatg      1080
     ctggcgctgg gtactgtgct gggaaccgct ttcggaatgg ttgccgttga gctgtttccg      1140
     caatatcacc tggaggcggg gacgtttgct attgccggaa tgggggcatt actggcggca      1200
     tctattcgcg cgccgttaac ggggatcatt ctggttctgg agatgaccga taactatcag      1260
     ctcattttgc caatgattat taccggtctt ggcgcaacac tattagcgca atttaccggc      1320
     gggaaaccgc tatactcggc gattcttgcg cgcacgctgg caaaacagga agctgagcaa      1380
     ctggcgcgaa gcaaggccgc atcagccagc gagaatactt ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page