(data stored in ACNUC10821 zone)

EMBL: AP010958.CUSC

AP010958.CUSC        Location/Qualifiers
FT   CDS_pept        634387..635769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusC"
FT                   /locus_tag="ECO103_0577"
FT                   /product="copper/silver efflux system protein CusC"
FT                   /note="outer membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0577"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29441"
FT                   /db_xref="GOA:C8U2T3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2T3"
FT                   /protein_id="BAI29441.1"
FT                   /translation="MSPCKLLPFCVALALTGCSLAPDYQRPAMPVPQQFSLSQNGLVNA
FT                   ADNYQNAGWRTFFVDNQVKTLISEALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNG
FT                   EGSGSWSGNLKGNTATTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHI
FT                   LLVSNVAQSYFNQQLAYAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIE
FT                   STRSDIAKRQGELAQANNALQLLLGSYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRP
FT                   DIMEAEHALMAANANIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEI
FT                   PIFNAGRNQANLDIAEIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLA
FT                   SLQITLQRARALYQHGAVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGW
FT                   QQ"
     atgtctcctt gtaaacttct gccattttgt gtggcccttg cgctaaccgg ttgttcactg        60
     gcaccggatt atcagcgtcc ggcaatgccc gtgccgcagc agttctcact cagccagaac       120
     ggcctggtta acgcagcaga taactatcag aacgcgggct ggcgcacctt ttttgttgat       180
     aatcaggtga agacgctgat tagcgaggcg ctggtgaata atcgggattt gcgcatggcg       240
     acgctgaaag tgcaggaggc acgggcgcaa tatcgtctga ccgatgccga ccgctaccca       300
     cagctcaatg gcgagggcag cggcagctgg agcggtaatc ttaaagggaa taccgccacg       360
     acacgggagt tttcgaccgg ccttaacgcc agctttgacc tcgatttttt cggtcgctta       420
     aagaacatga gcgaagccga gcgacaaaat tatttagcca ctgaggaagc tcagcgcgcg       480
     gtgcatattc tgctggtttc taatgtcgcg caaagctatt tcaatcagca actggcgtat       540
     gcgcaattgc aaatagccga agaaacgctg cgtaattatc agcagtcata tgcgtttgtc       600
     gaaaaacaac tgttgacagg tagcagtaat gttctggcgc tggaacaggc tcgcggggtg       660
     atagaaagta cccgcagcga catcgctaaa cgtcaggggg aactggcgca ggcgaataat       720
     gcattgcaac tgttattggg aagctacggc aagctgccgc aagcgcagac agtaaacagc       780
     gacagcctgc aaagcgttaa attaccggcg ggattgtcgt cgcaaatctt attgcagcgc       840
     ccggatatta tggaagctga acacgcgtta atggcggcta atgccaatat tggcgctgcg       900
     cgtgcggcat ttttcccgtc tatcagcctg accagcggaa tatcaaccgc cagcagcgat       960
     ctgtcttcat tatttaacgc tagcagcggg atgtggaatt ttattcctaa aattgagatc      1020
     cccattttta atgccggacg caaccaagcc aatctggata tcgccgaaat tcgccagcag      1080
     cagtcggtag tgaattatga acagaaaatc cagaacgcct ttaaagaagt ggcagatgcg      1140
     ctggcattac gtcaaagcct gaacgatcaa atcagcgccc agcagcgtta tctggcgtcg      1200
     ctgcaaatta ctttgcaacg ggcgcgggca ttatatcagc acggcgcggt aagttatctg      1260
     gaagtgctgg atgccgagcg ttctttattt gcaacccgac aaactttact cgacctgaat      1320
     tatgcccgtc aggttaacga aatttctttg tataccgcct tagggggcgg ttggcagcaa      1380
     taa                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page