(data stored in ACNUC10821 zone)

EMBL: AP010958.CUSF

AP010958.CUSF        Location/Qualifiers
FT   CDS_pept        635793..636125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusF"
FT                   /locus_tag="ECO103_0578"
FT                   /product="periplasmic copper-binding protein CusF"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0578"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29442"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2T4"
FT                   /protein_id="BAI29442.1"
FT                   /translation="MKKALQVAMFSLFTVIGFNAQANEHHHETMSEVQPQVISATGVVK
FT                   GIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQ
FT                   DIKVSQ"
     atgaaaaaag cactgcaagt cgcaatgttc agtctgttta ccgttattgg ctttaatgcc        60
     caggctaacg aacatcatca tgaaaccatg agcgaagtac aaccgcaggt tattagcgcc       120
     actggcgtgg taaagggtat tgatctggaa agcaaaaaaa tcaccatcca tcacgatccg       180
     attgctgccg tgaactggcc ggagatgacc atgcgcttta ccatcactcc gcagacgaaa       240
     atgagtgaaa ttaaaactgg cgacaaagtg gcgtttaatt ttgtccagca gggcaacctt       300
     tctttattac aggatattaa agtcagccag taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page