(data stored in SCRATCH zone)

EMBL: AP010958.FDRA

AP010958.FDRA        Location/Qualifiers
FT   CDS_pept        553874..555541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdrA"
FT                   /locus_tag="ECO103_0490"
FT                   /product="predicted acyl-CoA synthetase"
FT                   /note="contains NAD(P)-binding Rossmann-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29357"
FT                   /db_xref="GOA:C8U2J9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2J9"
FT                   /protein_id="BAI29357.1"
FT                   /translation="MIHAFIKKGCFQDSVSLMIISRKLSESENVDDVSVMMGTPANKAL
FT                   LDTTGFWHDDFNNATPNDICVAIRSEAADAGIAQAIMQQLEEALKQLAQGSGSSQSLTQ
FT                   VRRWDSACQKLSDASLALISVAGEYAAELANQALDRNLNVMMFSDNVTLEDEIQLKTRA
FT                   REKGLLVMGPDCGTSMIAGTPLAFANVMPEGNIGVIGASGTGIQELCSQIALAGEGITH
FT                   AIGLGGRDLSREVGGISALTALEMLSADEKSEMLAFVSKPPAEAVRLKIVNAMKATGKP
FT                   TVALFLGYTPAVACDENVWFASSLDEAARLACLLSRVTARRNAITPASSGFICGLYTGG
FT                   TLAAEAAGLLAGHLGVEADDTHHHGMMLDADGHQIIDLGDDFYTVGRPHPMIDPALRNQ
FT                   LIADLGAKPQVRVLLLDVVIGFGATADPAASLVSAWQKACAARSDNQPLYAIATVTGTE
FT                   RDPQCRSQQIATLEDAGIAVVSSLPEATLLAAALIRPLSPATQQHTPSLLENVAVINIG
FT                   LRSFALELQSASKPVVHYQWSPVAGGNKKLARLLERLQ"
     atgatccacg cctttattaa aaaagggtgt tttcaggatt cggtcagttt aatgattatt        60
     tcacgaaaac tcagcgaatc agaaaatgtt gatgatgttt ccgtaatgat gggtacgccc       120
     gccaataaag cgttattaga taccacaggt ttctggcatg acgattttaa taacgccacg       180
     ccgaacgata tttgcgtggc aattcgtagc gaagcggcgg atgcggggat cgcgcaggcg       240
     attatgcagc agcttgaaga ggcgctaaaa caactggcgc aggggtcagg cagcagccag       300
     tccttgacgc aggtgcgtcg ctgggacagt gcctgtcaga aattatccga tgccagtctg       360
     gcgctgattt cagtggctgg cgagtatgcg gcggagctgg cgaatcaggc gctggatcgc       420
     aacctcaacg tgatgatgtt ctccgataac gtcacgctgg aagatgaaat ccaacttaaa       480
     acccgcgcgc gagaaaaagg cttgctggtg atggggccgg actgcggtac gtcgatgatt       540
     gccggcacgc cgctggcttt tgctaacgtg atgccggaag gcaacattgg cgtcattggc       600
     gcttccggta ccgggattca ggagctgtgc tcacagattg cgctggcagg ggagggaatt       660
     actcacgcga ttggccttgg cgggcgcgac ctcagccgtg aagtgggcgg catcagtgcg       720
     ttgacggcgc tggaaatgct cagtgcagac gagaaaagcg aaatgctggc atttgtttca       780
     aaaccgcctg ccgaagctgt gcgtctgaaa attgttaatg ccatgaaagc aaccggcaaa       840
     ccgacggtgg cgctgttttt aggttatacc ccggcggtgg cctgcgacga gaatgtctgg       900
     tttgcctcct cgctggatga ggccgcacgc ctggcttgcc tgctttcacg cgttacggcg       960
     cgacgtaacg cgataacgcc tgccagcagc ggatttattt gcggtttgta taccggcggt      1020
     acgctggctg ccgaagcggc gggattactt gccgggcacc ttggcgtgga agccgacgat      1080
     acccatcatc acggcatgat gctcgacgcc gatggtcacc agattattga cctcggcgat      1140
     gatttctaca ccgtcgggcg tccccatccg atgatcgacc cagccttacg caatcagtta      1200
     attgccgatc tcggcgctaa accgcaagtg cgcgtattgc tgcttgatgt cgtgattggc      1260
     ttcggtgcga ccgccgatcc tgccgcctcg ctggtaagcg cctggcaaaa agcctgtgcc      1320
     gcgcgttcag acaatcaacc actgtatgcc attgccacgg tgacaggcac tgaacgtgac      1380
     ccgcaatgcc gctcgcagca aatcgccacg ctggaagatg cagggatcgc ggtagtgagt      1440
     tcgctgccgg aagccacctt gctggcggcg gcactgattc gtccgctttc gcctgccact      1500
     cagcaacaca caccgtcatt actggaaaac gtcgccgtga ttaacatcgg attacgcagc      1560
     tttgcgctgg agctacaaag cgccagcaaa ccggttgtgc attaccaatg gtcgccagtc      1620
     gccggcggca ataaaaaact ggctcgttta ttagaacgtt tgcaataa                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page