(data stored in SCRATCH zone)

EMBL: AP010958.FEPB

AP010958.FEPB        Location/Qualifiers
FT   CDS_pept        complement(661346..662302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepB"
FT                   /locus_tag="ECO103_0600"
FT                   /product="ferric enterobactin (enterochelin) binding
FT                   protein FepB"
FT                   /note="periplasmic component; periplasmic-binding component
FT                   of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29464"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2V6"
FT                   /protein_id="BAI29464.1"
FT                   /translation="MRLAPLYRNALLLTGLLLSGIAAVQAADWPRQITDSRGTHTLESQ
FT                   PQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIG
FT                   EPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEIT
FT                   GHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQL
FT                   GFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLL
FT                   AHLPAVQNKQVYALGTETFRLDYYSAMQVLERLKALF"
     gtgagactcg ccccgctcta ccgcaacgcc cttctattaa caggactttt gctttcagga        60
     atagccgcag ttcaggccgc tgactggccg cgtcagatta ctgacagccg tggcacacat       120
     acactggaaa gccagccgca gcgtattgtt tccaccagcg tcaccctgac cggctcactg       180
     ctggcgattg atgctccggt gatcgccagc ggcgcgacca cgccgaataa ccgcgtcgcg       240
     gatgaccagg gctttttacg ccagtggagc aaggtggcga aagaacgcaa actgcaacgg       300
     ctctatatcg gcgaaccgag cgccgaagcc gttgccgcgc aaatgccgga tctgatttta       360
     attagcgcaa ccggcgggga ttcggcgctg gcactgtatg atcagctttc caccatcgcc       420
     ccgacattaa tcatcaatta cgacgacaaa agctggcagt cgctgttaac gcagcttggc       480
     gaaattaccg ggcatgagaa acaagcggca gagcggattg cacagtttga taagcaactg       540
     gcagcggcga aagagcaaat caaattaccg ccgcagccgg tcactgccat tgtctatacc       600
     gccgctgcac acagtgccaa tctctggacg ccggaatcag cacaagggca gatgctggaa       660
     caactcggct ttacgctggc gaagttgccc gcagggttaa acgccagcca aagccagggc       720
     aaacgccatg acatcattca gcttggtggg gaaaatctgg ctgctgggtt aaatggcgag       780
     tcactattcc tgttcgccgg tgatcagaaa gatgccgatg cgatttatgc caatccactg       840
     ctcgcgcacc ttcccgcagt acaaaacaag caggtttatg cgctgggaac cgagacgttc       900
     cgtctggatt actacagcgc catgcaagtg ctggaacgac ttaaggcgct gttttaa          957
//

If you have problems or comments...

PBIL Back to PBIL home page