(data stored in ACNUC10821 zone)

EMBL: AP010958.FHUD

AP010958.FHUD        Location/Qualifiers
FT   CDS_pept        171973..172863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="ECO103_0152"
FT                   /product="iron-hydroxamate transporter subunit FhuD"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0152"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29030"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1M2"
FT                   /protein_id="BAI29030.1"
FT                   /translation="MSGLPLISRRRLLTAMALSPLLWQMNTAHAAAIDPNRIVALEWLP
FT                   VELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAHYEDFIR
FT                   SMKPRFVKRGERPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAV
FT                   SIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSA
FT                   MHFVRVLDNAIGGKA"
     atgagcggct tacctcttat ttcgcgccgt cgactgttaa cggcgatggc gctttctccg        60
     ttgttatggc agatgaatac cgcccacgcg gcggctattg atcccaatcg tattgtggcg       120
     ctggagtggt tgccggtgga attactgctg gcgctcggca tcgtgcctta cggcgtggcg       180
     gataccatca actatcgcct gtgggtcagc gaaccaccat tgccggactc agtgatcgac       240
     gtcggtttgc gcacagaacc taaccttgaa ctgctgaccg aaatgaaacc atcgtttatg       300
     gtctggtcgg caggatatgg cccttcacca gaaatgctgg ctcgtattgc gccggggcgt       360
     ggatttaact tcagcgacgg caaacagccg ctggcgatgg cgcgtaagtc actgacggaa       420
     atggcagatt tacttaacct gcaaagcgca gcagaaacgc atttagcgca ctatgaagac       480
     tttatccgca gcatgaaacc ccgctttgtg aagcgtggtg aacgcccgtt attgctgacg       540
     acgcttatcg atccgcgcca tatgctggtt ttcggtccaa acagcttgtt tcaggaaatt       600
     cttgatgagt acggcatccc aaatgcctgg caaggggaaa ccaacttctg gggcagtacc       660
     gccgtcagca tcgatcgtct ggcggcgtat aaagatgttg atgtgctctg ttttgatcac       720
     gacaacagca aagacatgga cgcgctaatg gcaaccccgc tgtggcaggc catgccgttt       780
     gtccgcgccg gacgctttca gcgcgtaccc gcagtctggt tttatggtgc gacgctctcg       840
     gcaatgcact ttgtgcgcgt tctggataac gccatcggag gtaaagcgtg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page