(data stored in ACNUC10821 zone)

EMBL: AP010958.FIXA

AP010958.FIXA        Location/Qualifiers
FT   CDS_pept        45594..46364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="ECO103_0043"
FT                   /product="predicted electron transfer flavoprotein subunit
FT                   FixA"
FT                   /note="contains ETFP adenine nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0043"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28923"
FT                   /db_xref="GOA:C8U1B5"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1B5"
FT                   /protein_id="BAI28923.1"
FT                   /translation="MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAA
FT                   CQLKQQAAEAQVTALSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQQTASAL
FT                   AAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAVNGVSKIISLTADTLTVEREL
FT                   EDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFNAEAAWSEQ
FT                   QVAAPKQRERQRIVIEGDGEEQIAAFAENLRKVI"
     atgaagatta ttacttgcta taagtgcgtg cctgatgaac aggatattgc ggtcaataat        60
     gctgatggtt cattagactt cagcaaagcc gatgccaaaa taagccaata cgatctgaac       120
     gctattgaag cggcttgcca gctaaagcaa caggcagcag aggcgcaggt gacggcctta       180
     agtgtgggcg gtaaagccct gaccaacgcc aaagggcgta aagatgtgct atcgcgcggc       240
     ccggatgaac tgattgtggt gattgatgac cagttcgagc aggcactgcc gcaacaaacg       300
     gcgagcgcac tggctgcagc cgcccagaaa gcaggctttg atttgatcct ctgtggcgat       360
     ggttcttccg acctttatgc ccagcaggtt ggtctgctgg tgggcgaaat cctcaatatt       420
     ccggcagtta acggcgtcag caaaattatc tccctgactg cagataccct caccgttgag       480
     cgcgaactgg aagatgaaac cgaaacctta agcattccgc tgcctgcggt tgttgctgtt       540
     tccactgata tcaactcccc acaaattcct tcgatgaaag ccattctcgg cgcggcgaaa       600
     aagcccgtcc aggtatggtc ggcggcggat attggtttta acgcagaggc agcctggtca       660
     gaacaacagg ttgccgcgcc gaaacagcgc gaacgtcagc gcatcgtgat tgaaggcgac       720
     ggcgaagaac agatcgccgc atttgctgaa aatcttcgca aagtcattta a                771
//

If you have problems or comments...

PBIL Back to PBIL home page