(data stored in ACNUC10821 zone)

EMBL: AP010958.GLTL

AP010958.GLTL        Location/Qualifiers
FT   CDS_pept        complement(722210..722935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="ECO103_0659"
FT                   /product="ATP-binding protein GltL of glutamate/aspartate
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0659"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29522"
FT                   /db_xref="GOA:C8U314"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C8U314"
FT                   /protein_id="BAI29522.1"
FT                   /translation="MITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIK
FT                   TVNGLEPVQQGEITVDGIVVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVK
FT                   VLKRDKAPAREKALKLLERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEP
FT                   TSALDPEMINEVLDVMVELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKDA
FT                   FFDDPKSDRAKDFLAKILH"
     atgattaccc tgaaaaatgt ttcaaaatgg tatggtcact ttcaggtgct gaccgactgc        60
     tcaaccgaag tgaaaaaagg cgaagtggtg gtggtttgcg gcccgtctgg ctccggcaaa       120
     tcaacgctga ttaaaaccgt caacggcctc gaaccagtgc agcaaggtga aatcaccgtc       180
     gatggtatcg tggttaatga caagaaaacc gatctggcaa agctgcgttc ccgcgtcggg       240
     atggtgttcc agcattttga gttgttccct catctgtcga ttatcgaaaa cctgaccctg       300
     gcgcaggtga aagtgcttaa acgcgataaa gcgccggctc gtgaaaaagc attgaaattg       360
     ctggagcgcg tgggactttc cgcacatgcc aataaatttc cggcgcagct ttccggcggt       420
     cagcagcagc gtgtggcgat cgctcgcgca ttgtgtatgg atcctattgc gatgctgttc       480
     gacgaaccga cgtcggcgct ggatccggag atgatcaacg aagtgctgga cgtgatggtg       540
     gaactggcga acgaaggaat gaccatgatg gtggtgaccc acgaaatggg ctttgcccgc       600
     aaagtggcga atcgggtgat ctttatggat gagggtaaaa ttgtcgaaga ctcgccgaaa       660
     gacgctttct tcgatgatcc gaaatcggac cgcgcaaaag acttcctcgc gaaaatcctg       720
     cattaa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page