(data stored in ACNUC10821 zone)

EMBL: AP010958.HOFC/HCPA

AP010958.HOFC/HCPA   Location/Qualifiers
FT   CDS_pept        complement(116123..117325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC/hcpA"
FT                   /locus_tag="ECO103_0106"
FT                   /product="assembly protein HofC in type IV pilin
FT                   biogenesis, transmembrane protein"
FT                   /note="component of type IV pilin biogenesis pathway,
FT                   probable chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0106"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28984"
FT                   /db_xref="GOA:C8U1H6"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1H6"
FT                   /protein_id="BAI28984.1"
FT                   /translation="MASKQLWRWHGITGDGNAQDGMLWAESRALLLMALQQQMVTPLSL
FT                   KRIAINSAQWRGDKSAEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDL
FT                   EQGIAFSNALLPWSEVFPPLYQAMIRTGELTGKLDECCFELARQQKAQRQLTDKVKSAL
FT                   RYPIIILAMAIMVVVAMLHFVLPEFAAIYKTFNTPLPALTQGIMTLADFSGEWSWLLVL
FT                   FGFLLAIANKLLMRRPTWLIVRQKLLLRIPIMGSLMRGQKLTQIFTILALTQSAGITFL
FT                   QGVESVRETMRCPYWVQLLTQIQHDISNGHPIWLALKNTGEFSPLCLQLVRTGEASGSL
FT                   DLMLDNLAHHHRDNTMALADNLAALLEPALLIITGGIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
     atggcgagta agcaactctg gcgctggcat ggcataaccg gcgacggcaa tgcgcaagat        60
     gggatgctat gggcagagag ccgtgctttg ctgctcatgg cactacagca acagatggtt       120
     accccactta gcctgaagcg aatcgccatc aattctgcgc agtggcgagg agataaaagc       180
     gcggaagtca ttcatcaact ggcgacgcta ctcaaagccg ggttaacgct ttctgaaggg       240
     ctggcactgc tggcggaaca gcatcccagt aagcaatggc aagcgttgct gcaatcgctg       300
     gcgcacgatc tcgaacaggg cattgctttt tccaatgcct tattaccctg gtcagaggta       360
     tttccgccac tctatcaggc aatgatccgc acgggtgaac tgaccggtaa gctggatgaa       420
     tgctgctttg aactggcgcg tcagcaaaaa gcccagcgtc agttgaccga caaagtgaaa       480
     tcagcgttac gttatcccat catcatttta gcgatggcaa tcatggtggt tgtggcaatg       540
     ctgcattttg ttctgccgga gtttgccgct atctataaga ccttcaacac cccactaccg       600
     gcactaacgc aggggatcat gacgctggca gactttagtg gcgaatggag ctggctgctg       660
     gtgttgttcg gctttctgct ggcgatagcc aataagttgc tgatgcgccg accgacctgg       720
     cttatagtgc ggcagaaatt gctgttacgc atcccgatta tgggttcact gatgcgggga       780
     caaaaactca cgcagatttt tacgattctg gcgctgacac aaagtgcagg cattactttt       840
     ttgcagggcg tagagagcgt cagagaaaca atgcgctgcc cgtactgggt gcaacttctg       900
     acacaaatcc agcacgatat cagtaacggt catcccatct ggctggcgct aaaaaatacc       960
     ggggagttta gcccgctctg tttgcaatta gtgagaacag gagaggcatc cggctcgctg      1020
     gacctcatgt tagacaacct cgcccatcat catcgggata acacaatggc gctggcggat      1080
     aacctcgcag ccttactgga accggcgttg ctgatcataa cgggaggaat tatcggtacg      1140
     ctggtggtgg cgatgtatct gccaattttc catttaggcg atgcgatgag tgggatggga      1200
     taa                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page