(data stored in SCRATCH zone)

EMBL: AP010958.HOKE

AP010958.HOKE        Location/Qualifiers
FT   CDS_pept        646374..646562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hokE"
FT                   /locus_tag="ECO103_0587"
FT                   /product="small toxic membrane polypeptide HokE"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0587"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29451"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2U3"
FT                   /protein_id="BAI29451.1"
FT                   /translation="MKPQDDISINPGATYPNLNNLDGSPFFAWRQYKHADEICPCGSHS
FT                   AVFNGAGIYASGRGFAV"
     atgaagcccc aggacgatat ttctatcaac cctggggcta cctacccaaa cctgaacaat        60
     ttggatggta gtcccttctt cgcatggagg caatataaac atgctgacga aatatgccct       120
     tgcggcagtc atagtgctgt gtttaacggt gctgggattt acgcttctgg tcggggattc       180
     gctgtgtga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page