(data stored in SCRATCH zone)

EMBL: AP010958.LFHA

AP010958.LFHA        Location/Qualifiers
FT   CDS_pept        complement(280269..282008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfhA"
FT                   /locus_tag="ECO103_0246"
FT                   /product="flagellar system protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0246"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29120"
FT                   /db_xref="GOA:C8U1W2"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1W2"
FT                   /protein_id="BAI29120.1"
FT                   /translation="MLSRSDLLTLLTINFIVVTKGAERISEVSARFTLDAMPGKQMAID
FT                   ADLNAGLINQAQAQTRRKDVASEADFYGAMDGASKFVRGDAIAGMMILAINLIGGVCIG
FT                   IFKYNLSADAAFQQYVLMTIGDGLVAQIPSLLLSTAAAIIVTRVSDNGDIAHDVRNQLL
FT                   ASPSVLYTATGIMFVLAVVPGMPHLPFLLFSALLGFTGWRMSKRPQAAEAEEKSLETLT
FT                   RTITETSEQQVSWETIPLIEPISLSLGYKLVALVDKAQGNPLTQRIRGVRQVISDGNGV
FT                   LLPEIRIRENFRLKPSQYAIFINGIKADEADIPADKLMALPSSETYGEIDGVLGNDPAY
FT                   GMPVTWIQPAQKAKALNMGYQVIDSASVIATHVNKIVRSYIPDLFNYDDITQLHNRLAS
FT                   MAPRLAEDLSAVLNYSQLLKVYRALLTEGVSLRDIVTIATVLVASSAVTKDHILLAADV
FT                   RLALRRSITHPFVRKQELTVYTLNNELENLLTNLVNQAQQGGKVMLDSVPVDPNMLNQF
FT                   QSTMPQVKEQMKAAGKDPVLLVPPQLRPLLARYARLFAPGLHVLSYNEVPDELELKIMG
FT                   ALS"
     atgctttcac gctcggattt actgacgctg ttgacaatca actttattgt cgtcaccaaa        60
     ggggccgagc gtatctccga ggtttctgcc cgctttaccc tggacgcgat gcccggtaag       120
     cagatggcga ttgacgccga tcttaatgcc gggttgatca atcaggcgca ggcacaaacc       180
     cgacgtaaag atgttgccag cgaggccgat ttctacggcg cgatggacgg ggcatcgaaa       240
     tttgtgcgcg gggatgctat cgccggtatg atgattctgg cgatcaacct gatcggcggc       300
     gtctgtatcg ggatcttcaa atacaacctg agcgccgacg ccgccttcca gcagtatgtg       360
     ctgatgacca tcggcgacgg gctggtggcg caaatccctt ccctgctact ctccaccgcg       420
     gcggcgatta tcgtcacccg cgtcagcgac aacggcgata tcgcccatga cgtgcgtaac       480
     cagttgctgg caagcccatc ggtgctctac accgctaccg gaattatgtt cgtactggcg       540
     gtagtgccgg gaatgccaca tctgccgttt ttgctgttca gcgccctgct tggctttacc       600
     ggctggcgga tgagcaaacg cccgcaggcg gcggaagcgg aagagaaaag tctcgaaacg       660
     ctgacccgca ccatcaccga aaccagcgag caacaggtca gttgggaaac cattccgctg       720
     atcgagccca tcagcttaag cctcggctac aagctggtgg cgctggtgga caaagcccag       780
     ggcaacccgc tcacccagcg tattcgcggc gtgcgacagg tgatatccga cggcaacggc       840
     gtgctgctgc cggagatccg cattcgggaa aacttccgcc ttaagcccag ccagtacgct       900
     attttcatca acggcattaa ggctgatgaa gcggatattc cggcggataa actgatggcg       960
     ctgccctcca gcgaaaccta cggcgagata gacggcgtgc tggggaacga cccggcgtac      1020
     gggatgccgg tgacctggat ccagcctgcg cagaaagcga aggcgctgaa tatggggtat      1080
     caggtgatcg acagcgccag cgtgattgct acccatgtaa ataagattgt gcgcagctat      1140
     attcctgatt tatttaacta tgacgatatt acgcagttgc ataaccgttt ggcgtcgatg      1200
     gcaccgcgcc tggcggagga tttaagcgcg gtgctcaatt acagccagtt gctgaaagtg      1260
     taccgggcgc tgctgaccga aggcgtttcc ctgcgcgata tcgtcaccat cgccaccgtg      1320
     ctggtcgcca gtagcgcggt gaccaaagat catattctgc tggcagccga tgtgcgcctg      1380
     gcgctgcggc gcagcattac ccatccgttc gttcgcaagc aggagctgac ggtgtatacc      1440
     ctgaataatg agctggaaaa tctgctgact aacctagtga atcaggcgca acagggcggt      1500
     aaagtgatgc tcgacagcgt gccagtggac ccgaatatgc tcaaccagtt ccagagcacg      1560
     atgccacagg tgaaagagca gatgaaagcg gcggggaaag acccggtgct gctggtgcca      1620
     ccgcagctgc gccctttgct ggcgcgttat gcaaggttgt ttgcgccggg gctgcatgtg      1680
     ctgtcgtata acgaagtgcc ggatgagctg gagttgaaga ttatgggggc gttgagttga      1740
//

If you have problems or comments...

PBIL Back to PBIL home page