(data stored in ACNUC10821 zone)

EMBL: AP010958.LIPB

AP010958.LIPB        Location/Qualifiers
FT   CDS_pept        complement(699316..699957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="ECO103_0637"
FT                   /product="lipoyl-protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0637"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29500"
FT                   /db_xref="GOA:C8U2Z2"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2Z2"
FT                   /protein_id="BAI29500.1"
FT                   /translation="MYQDKILVRQLGLQPYEPISQAMHEFTDTRDDSTLDEIWLVEHYP
FT                   VFTQGQAGKAEHILMPGDIPVIQSDRGGQVTYHGPGQQVMYVLLNLKRRKLGVRELVTL
FT                   LEQTVVNTLAELGIEAHPRADAPGVYVGEKKICSLGLRIRRGCSFHGLALNVNMDLSPF
FT                   LRINPCGYAGMEMAKISQWKPEATTNNIVPRLLENILALLNNPDFEYITA"
     ttgtatcagg ataaaattct tgtccgccag ctcggtcttc agccttacga gccaatctcc        60
     caggctatgc atgaattcac cgatacccgc gatgatagta cccttgatga aatctggctg       120
     gtcgagcact atccggtatt cacccaaggt caggcaggaa aagcggagca cattttaatg       180
     ccgggtgata ttccggtgat ccagagcgat cgcggtgggc aggtgactta tcacgggccg       240
     ggacaacagg tgatgtatgt gttgcttaac ctgaaacgcc gtaaactcgg tgtgcgtgaa       300
     ctggtgacct tgcttgagca aacagtggtg aataccctgg ctgaactggg tatagaagcg       360
     catcctcggg ctgacgcgcc tggtgtctat gtcggggaaa agaaaatttg ctcactgggt       420
     ttacgaattc gacgcggttg ttcattccac ggtctggcat taaacgtcaa tatggatctt       480
     tcaccatttt tacgtattaa tccttgtggg tatgccggaa tggaaatggc taaaatatca       540
     caatggaaac ccgaagcgac gactaataat attgttccac gtttactgga aaatatttta       600
     gcgctactaa acaatccgga cttcgaatat attaccgctt aa                          642
//

If you have problems or comments...

PBIL Back to PBIL home page