(data stored in ACNUC10821 zone)

EMBL: AP010958.METI

AP010958.METI        Location/Qualifiers
FT   CDS_pept        complement(221481..222134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="ECO103_0198"
FT                   /product="DL-methionine transporter subunit MetI"
FT                   /note="membrane component protein of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0198"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29074"
FT                   /db_xref="GOA:C8U1R6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1R6"
FT                   /protein_id="BAI29074.1"
FT                   /translation="MSEPMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQ
FT                   IIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK"
     atgtctgagc cgatgatgtg gctgctggtt cgtggcgtat gggaaacgct ggcaatgacc        60
     ttcgtatccg gtttttttgg ctttgtgatt ggtctgccgg ttggcgttct gctttatgtc       120
     acgcgtccgg ggcaaattat tgctaacgcg aagctgtatc gtaccgtttc tgcgattgtg       180
     aacattttcc gttctatccc gttcattatc ttgctggtat ggatgattcc gtttacccgc       240
     gttattgttg gtacatcgat tggtttgcag gcagcgattg ttccgttaac cgttggtgca       300
     gcaccgttta ttgcccgtat ggtcgagaac gctctgctgg agatcccaac cgggttaatt       360
     gaagcttccc gcgcaatggg tgccacgccg atgcagatcg tccgtaaagt gctgttaccg       420
     gaagcattgc cgggtctggt gaatgcggca actatcaccc tgattaccct ggtcggttat       480
     tccgcgatgg gtggtgcagt cggtgccggt ggtttaggtc agattggcta tcagtatggc       540
     tacatcggct ataacgcgac ggtgatgaat acggtactgg tattgctggt cattctggtt       600
     tatttaattc agttcgcagg cgaccgcatc gtccgggctg tcactcgcaa gtaa             654
//

If you have problems or comments...

PBIL Back to PBIL home page