(data stored in SCRATCH zone)

EMBL: AP010958.NFRB

AP010958.NFRB        Location/Qualifiers
FT   CDS_pept        complement(623271..625508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfrB"
FT                   /locus_tag="ECO103_0570"
FT                   /product="bacteriophage N4 receptor inner membrane subunit
FT                   NfrB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29435"
FT                   /db_xref="GOA:C8U2S7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2S7"
FT                   /protein_id="BAI29435.1"
FT                   /translation="MDWLLDVFATWLYGLKVIAITLAVIMFISGLDDFFIDVVYWVRRI
FT                   KRKLSVYRRYPRMSYRELYKPDEKPLAIMVPAWNETGVIGNMAELAATTLDYENYHIFV
FT                   GTYPNDPDTQRDVDEVCARFPNVHKVVCARPGPTSKADCLNNVLDAITQFERSANFAFA
FT                   GFILHDAEDVISPMELRLFNYLVERKDLIQIPVYPFEREWTHFTSMTYIDEFSELHGKD
FT                   VPVREALAGQVPSAGVGTCFSRRAVTALLADGDGIAFDVQSLTEDYDIGFRLKEKGMTE
FT                   IFVRFPVVDEAKEREQRKFLQHARTSNMICVREYFPDTFSTAVRQKSRWIIGIVFQGFK
FT                   THKWTSSLTLNYFLWRDRKGAISNFASFLAMLVMLQLLLLLAYESLWPDAWHFLSIFSG
FT                   SAWLMTLLWLNFGLMVNRIVQRVIFVTGYYGLTQGLLSVLRLFWGNLINFMANWRALKQ
FT                   VLQHGDPRRVAWDKTTHDFPSVTGDTRSLRPLGQILLENQVITEEQLDTALRNRVEGLR
FT                   LGGSMLMQGLISAEQLAQALAEQNGVAWESIDAWQIPSSLIAEMPASVALHYAVLPLRL
FT                   ENDELIVGSEDGIDPVSLAALTRKVGRKVRYVIVLRGQIVTGLRHWYARRRGHDPRAML
FT                   YNAVQHQWLTEQQAGEIWRQYVPHQFLFAEILTTLGHINRSAINVLLLRHERSSLPLGK
FT                   FLVTEGVISQETLDRVLTIQRELQVSMQSLLLKAGLNTEQVAQLESENEGE"
     gtggactggc ttcttgatgt ttttgcaacc tggctctacg gcttaaaagt aatcgcgata        60
     acgttagcgg tcatcatgtt catcagcgga ctggacgatt tttttattga tgtcgtctac       120
     tgggtacgcc gcattaaacg caagttgagt gtttatcgcc gctacccgcg aatgagttac       180
     cgcgaactgt ataaaccaga tgaaaaaccg ttagcgatta tggttccggc gtggaatgaa       240
     acgggcgtca tcggcaatat ggccgagctg gcggcgacca cgctcgacta cgaaaactat       300
     catatctttg ttggcaccta ccccaacgac cccgatactc aacgtgatgt tgacgaagtg       360
     tgcgctcgct ttccgaacgt gcataaggta gtctgcgcgc gtcctggtcc caccagcaaa       420
     gccgactgtc tgaacaacgt gctggacgcc atcacccagt ttgaacgtag cgccaatttc       480
     gcttttgctg gttttattct gcatgacgcc gaagatgtga tttcaccgat ggaattgcgt       540
     ctgttcaact atctggtcga gcgtaaagat ctgattcaga tcccggtgta tccgttcgaa       600
     cgcgaatgga cgcacttcac cagcatgact tacattgatg agttttcaga gctgcatggc       660
     aaagatgttc cggtgcgtga agccctcgcc ggacaagtgc ccagcgcagg cgtcggcacc       720
     tgtttcagcc gccgcgccgt gaccgctctg ttagctgacg gtgacggtat tgctttcgac       780
     gtgcagagtc tgactgaaga ttacgacatt ggtttccgcc tgaaagagaa aggtatgacg       840
     gaaatttttg tccgttttcc ggtggtggac gaagccaaag aacgcgagca gcgtaaattt       900
     ttacagcacg cacggacgtc aaacatgatc tgcgtgcgcg aatatttccc cgataccttt       960
     tcgactgcag ttcgacaaaa atctcgctgg atcatcggca ttgttttcca gggctttaaa      1020
     acccacaaat ggacctccag cctgacgctg aactactttc tctggcgcga ccgcaaaggg      1080
     gcaatcagta actttgccag cttcctcgcg atgctggtga tgctccagct tttgctgttg      1140
     ctggcgtatg aaagtttgtg gcccgatgcc tggcatttcc tttctatttt tagcggcagc      1200
     gcatggttaa tgaccctgct gtggctaaac tttggcttga tggttaaccg catcgtgcag      1260
     cgggtgattt tcgtcactgg ctactacggt ctgacgcagg ggctgttatc tgtcctgcgt      1320
     cttttctggg gcaacctgat taacttcatg gccaactggc gcgcgctaaa acaggtactt      1380
     caacacggcg atccacgtcg cgtcgcgtgg gataaaacaa cgcatgactt ccccagcgtg      1440
     actggcgata cccgctcgtt gcgcccgtta ggccaaattc tgctggaaaa tcaggtcatc      1500
     actgaagaac aactcgatac agcactgcgt aatcgcgtcg aaggtctacg cttgggcggt      1560
     tcaatgctga tgcaggggct gattagcgcc gagcagctgg cacaggcgct ggcagagcaa      1620
     aacggcgtgg cgtgggaatc catcgatgcc tggcagatcc cgtcctcgct gattgccgaa      1680
     atgccggcct ccgtagcgct gcattatgca gtactgccgc tgcgtctgga aaatgatgag      1740
     ttaattgtcg gcagtgaaga tggtattgac ccggtttcgc tggcggccct gacgcgtaaa      1800
     gtcggacgca aagtgcgtta cgtcattgtt ctgcggggac aaattgtcac ggggttacgt      1860
     cactggtatg cacgccgacg cggtcacgat ccgcgggcaa tgttgtacaa tgcggttcag      1920
     catcagtggc tcacggaaca gcaggccggt gaaatctggc ggcaatatgt gccgcatcag      1980
     ttcctgttcg ccgaaatact gaccacgctc ggtcatatta atcgttcagc aattaacgtg      2040
     ttgttattgc gccatgaacg cagttctctg ccgctcggca agtttttggt caccgaaggc      2100
     gttatcagcc aggaaacgtt ggatcgcgtc ctgacaattc aacgcgaatt acaagtttcg      2160
     atgcaatcac tattactcaa agcaggttta aacacagaac aggttgcgca actggagtcc      2220
     gaaaatgaag gagaataa                                                    2238
//

If you have problems or comments...

PBIL Back to PBIL home page