(data stored in ACNUC10821 zone)

EMBL: AP010958.PE212

AP010958.PE212       Location/Qualifiers
FT   CDS_pept        complement(239484..240398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0212"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29088"
FT                   /db_xref="GOA:C8U1T0"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1T0"
FT                   /protein_id="BAI29088.1"
FT                   /translation="MAGLRNNNNTQNAQWADYVGDILRGAQPINQLVPQHPYLNDVPLI
FT                   DELRHQNTHHVILLTLDVAKKILSPITSFDYIHFITTHPSGIKDTLAWLVNAGKLMTEF
FT                   DDNGKIIFNLNALKYTKASYFEILGEKYIKITTSSPWLLEKLGKYIFSSRAPQVLELAI
FT                   GWRGALSESIKGVKFCIWFSVAWRTIEFIMSSERDLVNFLGDFSMDVAKAVIAGGVATA
FT                   IGSLASFACVSFGFPVILVGGAILLTGIVCTVVLNEIDAQCHLSEKLKYAIRDGLKRQQ
FT                   ELDKWKRENMTPFMYVLNTPPVI"
     atggctggtt taaggaataa caacaacaca cagaatgcac agtgggctga ttatgtgggt        60
     gacattcttc ggggggctca gccgataaac cagctagtac ctcagcaccc ttatcttaac       120
     gacgtcccac tcattgatga gttaaggcat cagaacactc atcatgttat tctcttgaca       180
     cttgatgttg caaaaaaaat actcagccca ataacatcat ttgattacat tcattttatc       240
     actacacatc cttcaggtat aaaagataca ctcgcctggt tagttaacgc gggtaaatta       300
     atgactgagt ttgatgacaa tgggaaaatt atatttaacc ttaatgcctt aaagtataca       360
     aaagcaagtt actttgaaat acttggagag aaatatataa aaatcacaac atccagcccc       420
     tggcttttag aaaagctcgg taaatatatt ttctcttcac gagcgcctca agttctggaa       480
     ctcgctattg gctggcgagg agctttatct gaatcaataa aaggagttaa gttctgtatc       540
     tggttttcag tagcctggag aaccatagaa tttattatga gttcagagcg agatctggtt       600
     aattttcttg gcgatttttc aatggatgtg gccaaagcag ttatagccgg tggtgttgca       660
     accgctattg gaagcctggc ttcttttgcc tgtgttagct ttggctttcc agtaattctt       720
     gtcggaggag caattttact gacagggata gtgtgtacag ttgttttaaa tgaaatcgat       780
     gctcaatgcc atttatcaga aaaattaaaa tatgcaatta gagatggact aaaacggcaa       840
     caggaacttg ataaatggaa aagggaaaac atgactccat ttatgtatgt tcttaacact       900
     ccacccgtga tatga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page