(data stored in SCRATCH zone)

EMBL: AP010958.PE215

AP010958.PE215       Location/Qualifiers
FT   CDS_pept        complement(242311..245835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0215"
FT                   /product="IcmF-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0215"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29091"
FT                   /db_xref="GOA:C8U1T3"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1T3"
FT                   /protein_id="BAI29091.1"
FT                   /translation="MFRLPTPRLLSGLKSALRPAMPRFKVSAFWLLILAWIFLLVWIWW
FT                   KGPTWTLYEEQWLKPLANRWLATAAWGIIALMWLTVRVMKRLQQLEKQQKQQREEAIDP
FT                   LSVELNAQQRYLDRWLLRLQRHLDNRRFLWQLPWYMVIGPAGSGKTTLLREGFPSDIIY
FT                   APEGSRGAEQRLYLTPHVGKQAVIFDIDGTLCAPADADILHRRLWEHTLGWLKEKRARQ
FT                   PLNGIILTLDLPDLLTADKRRREYLLQTLRSRLQDIRQHLHCQLPVYVVLTRLDLLQGF
FT                   AALFQSLNRQDRDAILGVTFTRRAHENDDWRTELNAFWQTWVDRMNLALPDLMVAQTHT
FT                   RASLFSFSRQMQGSREPLVSLLEGLLDGENMNVMLRGVYLTSSLQRGQMDDIFTQSAAR
FT                   QYRLGNNPLASWPLVDTAPYFTRSLFPQALLAEPNLATESRDWLMRSRRRLTVFSATGG
FT                   VAALLLITGWHHYYNGNYQSGITVLKQAKAFMDVPPPQGKDDYGNLQLPLLNPVRDATL
FT                   AYGDWGDRSRLADMGLYQGRRIGPYVEQTYLQLLEQRYLPSLFNGLVKAMNAAPPESEE
FT                   KLAVLRVMRMLEDKSGRNNEVVKQYMAKRWSEKFHGQRDIQAQLMSHLDYALAHTDWHA
FT                   ERQAGDGDAISRWMPYDKPVVSAQKELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVG
FT                   PTFDQVFTSADDNKLVVPQFLTRYGLQSYFVKQRDELVELTAMDSWVLNLTRSVKYSDA
FT                   DRAEIQRQLTEQYISDYTATWRAGMDNLNIRNFESIGQLTGALEQVISGDQPLQRALTV
FT                   LRDNTQPGVFSEKLSAKERDEALAEPDYQLLTRLGHEFAPENSTLAVQKDKESTMQAVY
FT                   QQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPIFATRQMAKTLPAPLNRWVGR
FT                   LADQAWHVVMVEAVHYMEVDWRDSVVKPFNEQLANNYPFNPRSAQDASLDAFERFFKPD
FT                   GILDTFYQQNLKLFIDNDLSLEDGDNSVIIREDIIAQLKTAQKIRDIFFSKQNGLGTSF
FT                   AVETVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGNAP
FT                   RSISFSGPWAQFRLFGAGQLTGVQDGNFTVRFSVDAGAMTYRVHTDTEDNPFSGGLFSQ
FT                   FGLSDTLY"
     gtgttcagat taccaacacc ccgactactc agcggactca aatcagccct gcgaccggcg        60
     atgccccggt ttaaagtctc tgctttctgg ctgctgatac tggcgtggat ttttctgctg       120
     gtgtggatct ggtggaaagg cccgacgtgg acgctgtatg aagaacagtg gctcaaacca       180
     ctggcgaacc gctggctggc aacggcggcg tgggggatta ttgccctgat gtggcttacc       240
     gtccgggtga tgaagcgcct gcaacagctt gaaaaacagc aaaaacaaca gcgcgaggaa       300
     gccattgatc cgctcagtgt ggaactgaac gcccagcagc gttacctcga ccgctggctg       360
     ctgcgcctgc aacgccatct cgacaaccgc cgtttcctgt ggcaattgcc gtggtatatg       420
     gtcatcggcc cggcgggcag tggcaaaacg acactgctgc gcgaggggtt tccgtcagac       480
     attatttatg ccccggaggg ctcgcgcggc gcagaacaac gcctgtacct tacgccccat       540
     gtcggtaaac aggcggtgat ctttgatatc gacggcacac tctgcgctcc cgctgatgcg       600
     gatatcctgc atcgccgtct gtgggaacat accctcggct ggctgaagga aaagcgcgcg       660
     cgccagccgc tgaacgggat tattctgaca ctcgatttac ccgatctgct gaccgcagac       720
     aagcgccgcc gtgagtatct gctacagacg ctgcgcagcc gcttgcagga tatacgccag       780
     catcttcact gccagctacc ggtttacgtg gtactgaccc ggcttgattt attgcagggt       840
     tttgccgccc tgttccagtc cctgaacaga caggatcgtg atgcgattct gggtgtcacg       900
     ttcacccgcc gtgcccatga aaatgatgac tggcgaacag agttgaatgc tttctggcag       960
     acatgggtgg atcgaatgaa tctggcgttg ccggatctga tggtcgctca gactcacacc      1020
     cgcgcgtctt tattcagttt ttcccgccag atgcagggaa gccgtgaacc cctggtgtca      1080
     ctgcttgaag gtctgcttga cggcgaaaat atgaacgtga tgctgcgtgg tgtctatctc      1140
     acctcgtcac tgcaacgcgg ccagatggat gacatcttta cccagtccgc cgcccgccag      1200
     taccggctgg gcaataaccc actggcgtcc tggcccctgg tggacaccgc gccttatttc      1260
     acccgcagcc tgttcccgca ggcattactc gcagagccta atctggcaac ggagagccgt      1320
     gactggctga tgcgttcccg tcgccgcctg acggttttct ctgccacagg cggcgtggcg      1380
     gcactgctgc tcatcaccgg ctggcatcac tattacaacg gtaactatca gtccggcatc      1440
     accgtgctta agcaggccaa agcctttatg gacgtgccgc ctccgcaggg gaaagacgac      1500
     tacggcaacc tgcaactgcc gctgctgaac ccggtacgcg atgccacact ggcctatggc      1560
     gactggggcg accgcagccg tctggccgat atgggactgt accagggacg acgtatcggg      1620
     ccttatgtgg aacagaccta tctgcaacta ctagagcagc gttacctgcc ctcgctgttt      1680
     aacgggctgg tcaaagcgat gaacgccgcg ccgccggaga gtgaggaaaa actcgccgtg      1740
     ctgcgcgtga tgcgaatgct ggaggacaaa agcggacgca ataatgaggt agtgaagcag      1800
     tatatggcaa aacgctggag cgaaaagttc cacggccagc gtgatatcca ggcacaactg      1860
     atgtcccatc ttgactacgc gctggctcat actgactggc atgcagagcg tcaggcgggc      1920
     gacggtgacg ccatcagccg ctggatgcca tatgacaagc ccgtggtatc agcacagaaa      1980
     gaactgagca aactgcctgt ctaccagcgg gtttaccaga gcctgaaaac gcgggcgctg      2040
     ggcgttctac ctgctgacct caatctgcgt gaccaggtag ggccaacctt tgaccaggtc      2100
     tttacatctg ccgatgacaa caaactggtt gttccacagt ttcttacccg ttacggcctg      2160
     caaagctatt ttgtaaaaca gcgcgatgaa ctggttgaac tgacggcaat ggattcctgg      2220
     gtactcaacc tcacccgcag tgtgaaatac agtgacgccg accgcgcgga aatccagcgc      2280
     cagttgaccg agcagtatat cagcgactac accgctacct ggcgagccgg gatggacaat      2340
     ctgaatatcc gcaattttga gtccattgga caactgaccg gggcgctgga gcaggttatc      2400
     agcggcgacc agcctttgca gcgggcgctg actgtgttgc gtgacaacac acagccaggc      2460
     gtcttttctg aaaaactttc tgccaaagaa cgggatgagg ctctggcaga accggactac      2520
     cagttgctca cccgcctcgg gcatgaattt gccccggaaa acagtactct ggcagtacag      2580
     aaagacaaag aaagcacgat gcaggccgtg tatcagcaac tcaccgagtt gcaccgctat      2640
     ctgctggcaa ttcagaacgc gcctgtacca gggaaatcgg cgctgaaagc cgtgcagttg      2700
     cggcttgatc agaacagcag cgatccgata ttcgccaccc gccagatggc aaagacactg      2760
     cctgctccgc tcaaccgctg ggttggcaga ctggctgacc aggcctggca tgtggtgatg      2820
     gtggaggccg ttcactatat ggaagtggac tggcgcgaca gcgtggtgaa accgtttaac      2880
     gagcaactgg caaataacta tccgtttaat ccgcgttctg cacaggatgc ctcactggat      2940
     gccttcgaac gcttctttaa accggatggc atactggata ccttctacca gcagaacctg      3000
     aagctgttta tcgacaatga cctgagtctg gaggatggcg ataacagcgt cattattcgc      3060
     gaagatatta ttgcgcaact gaaaaccgcg cagaaaatcc gtgacatctt cttcagtaaa      3120
     cagaacggtc tgggaacatc ctttgccgtg gaaacggtat cgctctccgg caacaaacgc      3180
     cgcagtgtac tgaaccttga cggccagtta gtcgattaca gccaggggcg caactatacc      3240
     gcccatctgg tctggcctaa caatatgcgc gaaggcaacg aaagcaaact gacgctcatc      3300
     ggcaccagcg gcaacgcacc gcgcagtatc agcttcagcg ggccgtgggc gcagttccgc      3360
     cttttcgggg ccggacaact gaccggagtt caggatggca actttaccgt gcgctttagc      3420
     gtggacgctg gcgcgatgac ctaccgtgtg cataccgaca ctgaggataa cccattcagc      3480
     ggtgggttat tcagccagtt tggtctgtca gacacactgt actga                      3525
//

If you have problems or comments...

PBIL Back to PBIL home page