(data stored in ACNUC10821 zone)

EMBL: AP010958.PE216

AP010958.PE216       Location/Qualifiers
FT   CDS_pept        complement(245854..247266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0216"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0216"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29092"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1T4"
FT                   /protein_id="BAI29092.1"
FT                   /translation="MAMDLRDPNVWISHLLENLPEEKLASALKDDNPNWEYIDGEIVKL
FT                   GSLAHSQLDIPELQRRGLVILASESKDFRLLAHLLRTLQHAGDPHLALRLLALYVEHYW
FT                   AVAAPQNMAHKKRFASQVIKRFETGIEVFSQNAATAQRDALSGELAKLAQCWQSHNAPE
FT                   LAQATDDLFALYQRAFNRAAPAPVPTPAASGSSPQTTATSESGVTQPSAPAPQIVIDSH
FT                   DDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQNITSTPQAESDGRTPLAAVSADM
FT                   VADYHAQLGSADMALWQQVEKSVLLAPYWLDGHCLSAQTALRLGYKQVADAIRDEVIRF
FT                   LERLPQLTGLLFNDHTPFISEQTKQWLAASPDAKVAPVAQIGEESKAARACFAEQGLEA
FT                   ALRYLDMLPEGDPRDQFHRQYLAAQLTEEAGLVQLAQQQYRMLFRMGLQMMVADWEPSL
FT                   LEQLEQKFTAEQ"
     atggcaatgg acttacgcga tccgaatgtc tggatatcgc acctgctgga aaacctgccg        60
     gaagagaaac tggcatcggc gctgaaagat gacaacccga actgggagta tatcgacggc       120
     gaaatcgtca agctgggatc gctggcccac agtcaactgg atatcccgga actccagcgc       180
     cgggggctgg tcattctggc ttcggagagt aaggattttc gtctgctggc gcatctgctg       240
     agaaccctgc aacacgccgg tgatcctcat ctcgcattgc gcctgctggc gctgtatgtg       300
     gagcattact gggcggtggc tgcgccgcag aatatggcgc ataaaaaacg ctttgccagc       360
     caggtcatta aacgctttga aacaggtatt gaagtttttt cacagaacgc cgccacagcg       420
     cagcgcgatg cgctgtcagg ggaactggca aaactggcgc aatgctggca gtcacataac       480
     gccccggaac tggcacaggc tactgatgat ctttttgccc tgtaccagcg tgcgtttaat       540
     cgtgcggcac cggctcctgt ccccactccg gcggcctccg gtagttcacc acagaccacc       600
     gccacgtctg aaagcggcgt gacgcaaccc agtgctccgg ctccccaaat cgtcatcgac       660
     agtcacgacg acaaagcctg gcgcgacacg ctgttaaaag tggcggccat tttatgtgaa       720
     cgccagccgg attcaccgca gggctaccgt ctgcgccgcc atgcgctttg gcagaacatc       780
     accagtacgc cccaggcgga aagcgatggc cgtactccac tggctgcggt ctccgccgat       840
     atggtggcag attaccatgc tcagctcggt agtgccgata tggcgctgtg gcagcaggtg       900
     gagaaaagcg tactgctggc tccttactgg ctggatggtc actgcctttc tgcacagacg       960
     gcgctgcgtc tgggttacaa acaggtggca gacgccatcc gcgatgaggt catccgcttc      1020
     cttgagcgtc tgccccagct taccgggctg ctgtttaatg accacacacc gtttatcagt      1080
     gagcagacga aacaatggct ggcagcttcg cccgacgcca aagttgcacc ggttgcgcaa      1140
     atcggtgagg aatcgaaggc agccagagcc tgttttgctg agcagggtct ggaggcggcg      1200
     ctgcgatatc tggacatgct acccgaaggc gatccccgcg atcagtttca ccgccagtac      1260
     cttgccgcac agttgacgga agaggcgggg ctggtacagc ttgcgcagca gcagtaccgg      1320
     atgttgttca ggatgggatt gcagatgatg gtggcagact gggagccgtc cctgcttgag      1380
     cagctagaac aaaaattcac ggcagaacaa taa                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page