(data stored in SCRATCH zone)

EMBL: AP010958.PE219

AP010958.PE219       Location/Qualifiers
FT   CDS_pept        complement(250785..251546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0219"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0219"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29095"
FT                   /db_xref="GOA:C8U1T7"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1T7"
FT                   /protein_id="BAI29095.1"
FT                   /translation="MDEGSLSLPPFTGYDEKSQRNYHLALRGNSLNPMIDAATPLLGMV
FT                   MRLSTMNSQTMPEHLFAQVVTDVQAVEQLLQEQGYEPGVIISFRYIPCTFIDEAALGNG
FT                   WSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIREPKRYQDLLEFLWICFSLGFRGRY
FT                   KVAAQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLISRLTVKHIFCGG
FT                   VVVLALFYLFYLLRLDSQTQDILHQLNKLLR"
     atggatgagg ggtcactgtc tctgccacca tttaccggat acgacgaaaa aagccagcgc        60
     aactaccatc tcgcgcttcg tggcaacagc ctgaatccga tgatcgacgc ggccacgccg       120
     ctactcggta tggtaatgcg cctttcaacc atgaacagcc agacgatgcc ggagcatctt       180
     tttgctcagg tggtgacgga tgttcaggcc gtggagcaac tgcttcagga gcagggctac       240
     gaaccgggcg tgattatctc gtttcgctac atcccctgca cgtttattga tgaagcggcg       300
     ctcggtaacg gctggtcaaa caagaacgag tggatcaagc agtcattgct ggtccatttc       360
     cacaacgaag cctggggtgg agagaaagtt ttcatcctgc tggagcgcct gatccgtgaa       420
     cccaaacgtt accaggatct gctggaattt ctctggatct gtttttctct gggatttcgc       480
     gggcgctaca aagtggcagc acaggatcag ggggaatttg agcagatcta ccgccgtctg       540
     taccacgttc tgcataaact gcgcggcgat gcccctttcc cgctgttaca ccaggacaaa       600
     aaaacccagg gcgggcgtta tcagctcatc agtcgcctga ctgttaaaca tattttttgt       660
     ggtggcgttg tcgtgctggc gttgttttac ctgttctatc tgttgcggct ggacagccag       720
     acgcaggaca tcctgcacca gctaaacaaa ttacttcgat aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page