(data stored in ACNUC10821 zone)

EMBL: AP010958.PE222

AP010958.PE222       Location/Qualifiers
FT   CDS_pept        complement(253406..254686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0222"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0222"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29098"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1U0"
FT                   /protein_id="BAI29098.1"
FT                   /translation="MPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHGPECHWSV
FT                   QDRQQSIPAQAFTVILHDGTFCLRPQTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMV
FT                   RVHLNRGDIPHYDEEMATPETIVTNRDMLTDTLLSTEGTPHYPGMTHRHQLADTVVNGF
FT                   SADPLQALQSESLITTGDPLSGIAAVRPSAPLSDPASNGGINTPFMDLPPIYASPGDRN
FT                   DDVSAAEMAQRHLAVTPLLRGLGGSLTMSNSDDADDFLEEAGRTLQAAIKGLLDLQQQR
FT                   NSLSDKHLRPLEDNPLRLNMDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEAN
FT                   RAAIVESLRVLLDAFSPQNLLRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQ
FT                   GFEMLFNEVYAQVYDRVLREKQREPEA"
     atgccggaag agaaactaca gacgctttca ttgcaggtca ttaacggcag tgagctggaa        60
     agcggacggg cggcgcgctg tctgttcaca cagcagggaa atgtcggcca tggccccgaa       120
     tgccactggt cggtacagga tcgtcagcag agcattccgg cccaggcttt taccgttatc       180
     ctgcacgatg gcacattttg tctgcgcccg cagacggcac aactgtggct gaatcaggca       240
     aaagtcacag caacatcaga cctaatacag ttgcgccagg gcgatgagat ccagatcgga       300
     cggctgatgg tgagggttca tctgaaccgg ggagatattc cccattacga tgaggaaatg       360
     gccactcccg aaaccatcgt taccaatcgc gatatgctca cggataccct gctatcaacg       420
     gagggtacgc cacactatcc gggaatgact caccggcacc aacttgcaga caccgtggta       480
     aacggttttt ctgccgatcc actccaggca cttcagtccg aaagcctgat taccacgggc       540
     gatccgcttt caggcattgc ggctgtccgg ccatcggcac cgctgtccga tccggcaagt       600
     aatgggggga tcaatactcc gtttatggat ctgccgccca tttatgccag ccccggcgat       660
     cgtaatgacg acgtctctgc ggcagaaatg gcgcaacgcc accttgcggt caccccctta       720
     ctgcgcggtc ttggcggctc gcttaccatg agcaattccg acgatgcgga tgattttctg       780
     gaggaggccg gacgaacgtt acaggccgca ataaaaggtc tgctcgattt gcagcagcag       840
     cgtaacagcc tctcagacaa acatttgcgc ccgctggaag ataacccgct gcgcctgaac       900
     atggattacg ccaccgcgct cgacgtaatg tttgccgaag gtaaaagccc ggtacatctg       960
     gcggctcccg ccgccgtcag tgaaagcctg cgcaatgtcc gccaccacga agaagctaac      1020
     cgggcagcga ttgtggagtc gcttcgtgtc ctgctggatg ctttctcacc acaaaatctg      1080
     ctgcgccgct ttgtgcagta ccgccgcagc catgaactgc gccagccgct ggatgatgcc      1140
     ggagcatggc aaatgtacag ccattattac gaagaactgg cctccgatcg ccagcagggg      1200
     tttgagatgc tgtttaacga ggtctacgcc caggtctatg accgggtgct tcgtgaaaaa      1260
     cagcgggagc cggaagcatg a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page