(data stored in ACNUC10821 zone)

EMBL: AP010958.PE23

AP010958.PE23        Location/Qualifiers
FT   CDS_pept        complement(22137..23558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0023"
FT                   /product="T3SS effector-like protein EspX-homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0023"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28903"
FT                   /db_xref="UniProtKB/TrEMBL:C8U195"
FT                   /protein_id="BAI28903.1"
FT                   /translation="MTNGISTSPHCLYKSNIVDDVIINKTRQNELVKVFCEYKTEFLIL
FT                   FDDFFRSHNLPKPSPVLHHFFQYTHLRDAYFYRCKLIEHTVQFYFFKHKGITLLRLDVF
FT                   DDRTSECLSEEIKIYQECHEKFVNFLKANFNQEIYPQLYTPEIFYEACRNLQSFYDHQE
FT                   TSQNAKYSAIDKKKSHLNQEIKKLIKKNIFPELYNEQCNKIPSSSIDDNQGIMWQNFKT
FT                   SNIAYSQPCKKLSLFKSIPSRLIKKSAYCSTENTITNKFDVVFSYCGNNVKEFILLLPY
FT                   NKSLEMHELNEQNIQYLTALNINIHKMLLSNITIEKSDLSYGYYFGCVLSNILCFESDL
FT                   SNTIFSNGEINNLFIKKSNIFGASFTNTRIKNLLCVDIMPGRWTTQLVNKHLGYRYTGV
FT                   FKTLASIDDKPSRFEILIPLVQTLVRDNVKLNNDVYKELNKFMHDYDKTSSEMRKYLKS
FT                   INECMFLMKNIAHQN"
     atgacaaatg gtatctcaac ttcgccacat tgtctttata aatcaaatat agtagatgat        60
     gtaataataa ataaaacaag acaaaatgag ttagtaaaag tattttgcga gtataaaaca       120
     gagttcttaa ttttgtttga tgactttttt agaagccata acttgcctaa accatctcca       180
     gtccttcatc atttttttca atatactcat ctgagagatg catattttta tagatgtaaa       240
     ctcatagaac atacagttca attttatttt tttaaacaca aaggtatcac attacttaga       300
     ttggatgttt ttgatgacag aacaagcgaa tgtctttctg aagagattaa gatataccaa       360
     gaatgccatg aaaaattcgt taatttttta aaggcaaact tcaaccaaga aatataccca       420
     cagctatata ctcctgaaat attttatgag gcctgcagaa atctccagtc attttatgat       480
     catcaggaaa cgtcacaaaa cgcaaaatac agtgcaatag acaagaaaaa aagtcatctt       540
     aaccaggaaa tcaaaaagct tattaaaaaa aatattttcc ctgagctata caatgagcaa       600
     tgcaataaaa tcccctcctc atcgatagat gataaccagg gaataatgtg gcagaacttt       660
     aaaactagca atattgcata ttcacaacca tgtaaaaaat tatctttatt taaaagcata       720
     cccagtcgat taataaaaaa atcagcttac tgctcaactg aaaacacaat caccaataaa       780
     tttgatgttg tcttttctta ctgcggaaat aatgtaaagg aatttatact tttattaccc       840
     tataataaat ctctggagat gcatgaactt aacgagcaaa acatccagta tttgactgcc       900
     cttaatatta atatacataa aatgttgcta tcaaatataa caatagaaaa gagcgacctt       960
     tcatatgggt attattttgg ttgtgtatta tccaatatat tatgttttga aagcgactta      1020
     tcaaacacca tcttttcaaa tggagaaatt aataatctct tcattaaaaa aagcaacata      1080
     tttggagcat cattcactaa taccagaata aaaaatttgc tctgtgtaga tattatgcct      1140
     ggtcgatgga ccactcaact tgtcaataag cacttaggtt acagatacac aggagtattc      1200
     aaaaccctgg caagtattga tgacaaaccg tcccgtttcg aaattttgat accattggta      1260
     caaactttag ttcgcgacaa tgtaaagcta aataatgatg tgtataaaga acttaataag      1320
     tttatgcacg attacgacaa aacatcatca gaaatgagaa aataccttaa aagcatcaac      1380
     gagtgtatgt tccttatgaa aaacatagct catcaaaatt aa                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page