(data stored in SCRATCH zone)

EMBL: AP010958.PE231

AP010958.PE231       Location/Qualifiers
FT   CDS_pept        263958..268205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0231"
FT                   /product="fused putative RhsG core protein with
FT                   extension/putative RhsI core protein"
FT                   /note="RhsG/RhsI"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29107"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1U9"
FT                   /protein_id="BAI29107.1"
FT                   /translation="MGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPNSPIE
FT                   EQKGNPVNPLLGAKVLPGETDLALPGPLPFILSRAYSSYRTRTPAPVGVFGPGWKAPFD
FT                   IRLQIRDEGLILNDSGGRSIHFEPLFPGEISYSRSESLWLARGGVAAQHSSQPLSALWQ
FT                   VLPEDVRLSPHVYLATNSLQGPWWILSWPERVPGADEVLPPEPPAYRVLTGVVDGFGRT
FT                   LAFHRAAEGDVAGAVTGVTDGAGRRFHLVLTTQAQRAEVFRKQRATSLSSPAGPRSASS
FT                   SLVFPDTLPAGTGYGTDNGIRLEAVWLTHDPAYPDEQPTAPLARYTYTAGGELRAVYDR
FT                   SGTQVRGFTYDAEHAGRMVAHHYAGRPESCYRYDDTGRVTEQVNPEGLDYRFEYGESRV
FT                   IITDSLNRREVLYTEGEGGLKRVVKKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYSL
FT                   HMASGAVTAVTGPDGRTVRYGYNSQRQVTSVTYPDGLRSSREYDERGRLTAETSRSGET
FT                   TRYSYDDPASELPTGIQDATGSTKQMAWSRYGQLLAFTDCSGYTTRYEYDRYGQQIAVH
FT                   REEGISTYSSYNPRGQLVSQKDAQGREIRYEYSAAGDLTATVSPDGKRSTIEYDKRGRP
FT                   VSVTEGGLTRSMGYDAAGRITVLTNENGSQSTFRYDPVDRLTEQRGFDGRTQRYHYDLT
FT                   RKLTQSEDEGLITLWHYDASDRITHRTVNGDPAEQWQYDEHGWLTTLSHTSEGHRVSVH
FT                   YGYDDKGRLTGERQTVENPETGELLWQHETKHAYNEQGLANRVTPDSLPPVEWLTYGSG
FT                   YLAGMKLGGTPLVEYTRDRLHRETVRSFGSRAGSNAAYELTSTYTPAGQLQSQHLNSLV
FT                   YDRDYGWNDNGDLVRISGPRQTREYGYSATGRLESVRTLAPDLDIRIPYATDPAGNRLP
FT                   DPELHPDSTLTAWPDNRIAEDAHYVYHYDEYGRLTEKTDRIPTGVIRTDDERTHHYHYD
FT                   SQHRLVFHTRIQHGEPLVESRYLYDPLGRRMAKRVWRRERDLTGWMSLSRKPEETWYGW
FT                   DGDRLTTVQTDTTRIQTVYQPGSFTPLIRVETENGEREKAQRRSLAEKLQQEGSEDGHG
FT                   VVFPAELVGLLDRLEGEIRANCVSSESRQWLAQCGLTVERLAAQIEPVYLPERKIHLYH
FT                   CDHRGLPLALISEDGNTAWSAEYDEWGNQLNEENPHHLHQPYRLPGQQYDKESGLYYNR
FT                   HRYYDPLQGRYITPDPIGLRGGWNMYQYPLNPIQVIDPMGLDAIENMTSGGLIYAVSGV
FT                   PGLIAANSITNSAYQFGYDMDAIVGGAHNGAADAMRHCYLMCRMTKTFGSTIADVIGKN
FT                   HEAAGDRQGQPAKERIMDLKNNTVGIACGDFSAKCSDACIEKYNTGQLFGLDGIKADNP
FT                   IKAKQGSSDASNY"
     atgggcggaa aaccggcggc gcggcagggt gatatgaccc gcaagggact ggatattgtg        60
     cagggttcag cgggggtgct gataggtgcg ccgacgggag tggcctgttc ggtatgtccc       120
     aacagcccga tagaggagca gaagggtaac ccggtgaacc cgctgctggg agcaaaggtg       180
     ctgccgggcg agacggacct tgcgctgccc ggcccgctgc cgtttattct ttcccgcgcc       240
     tacagcagct accggaccag aacacccgcg ccggtggggg tgtttggtcc cggctggaaa       300
     gcgcccttcg atatccgctt acagatacgc gatgaaggcc tgatactcaa cgacagcggc       360
     ggcaggagca ttcactttga gccgctgttt cccggcgaga taagctacag ccgcagcgag       420
     tcactctggc tggcgcgggg cggagtagcg gcgcagcaca gttcgcagcc gctaagcgcg       480
     ctctggcagg tgctgccgga agatgttcgc ctgagtccgc atgtgtacct ggcgacaaac       540
     agccttcagg ggccgtggtg gatactcagc tggccggagc gggtgccggg ggcggacgag       600
     gtgctgccgc cggagccgcc cgcataccgg gtgctgacgg gcgtggtgga cggcttcggg       660
     cggacgctgg cctttcaccg ggcggcggag ggtgatgtgg cgggcgcggt gacgggggtg       720
     acggacggcg cgggccgccg ttttcacctg gtgctgacca cacaggcaca gcgggcggaa       780
     gtattccgta aacagcgcgc cacgtcttta tcttcccctg ccggtccccg ttctgcttcc       840
     tcttctctgg ttttccccga cacgctgccc gccggtacag gatacggcac ggataacggt       900
     atccggctgg aggcggtatg gctgacacac gacccggcat acccggatga acagccgact       960
     gcgccgctgg cgcgctacac gtacacggcc ggtggtgaac tgcgggcggt gtatgaccgc      1020
     agcggaacgc aggtgcgcgg gtttacttat gatgcggagc acgccgggcg gatggtggcg      1080
     caccattatg cggggaggcc ggagagctgc taccggtatg atgataccgg tcgggtgacg      1140
     gagcaggtca acccggaggg gctggactac cgctttgagt acggagagag ccgggtaatc      1200
     atcacggaca gcctgaaccg gcgggaggtg ctgtacacgg aaggcgaggg tggcctgaag      1260
     cgggtggtga agaaggaaca tgcggacggg agcattaccc gcagcgagta tgatgaggcg      1320
     gggaggctga aggcacagac ggatgcggcg gggcggcgga cggagtacag cctgcatatg      1380
     gcgtcgggtg cggtgacggc ggtgacgggg ccggacggca ggacggtgcg gtatggctat      1440
     aacagccagc ggcaggtgac gtcagtgacg tacccggacg ggcttcgcag cagccgggag      1500
     tatgatgaga ggggaaggct gacggcggag acctcgcgca gcggtgagac aacgcggtac      1560
     agctatgatg acccggcgag tgagctgccg acagggatac aggacgcgac gggcagtaca      1620
     aaacagatgg catggagccg ttacggtcaa ctgctggcct tcacggactg ctcggggtac      1680
     acgacgcggt atgagtacga ccggtacggt caacaaatcg ccgttcaccg ggaggaaggc      1740
     atcagcactt acagcagtta taacccgcgt gggcaactgg tcagtcagaa ggatgcgcag      1800
     gggcgtgaaa tccgttatga gtacagcgcc gcaggcgacc tgacagcaac ggtatcaccg      1860
     gacggtaaac gcagcaccat cgaatatgat aaacgcgggc gtccggtgag tgtgacggaa      1920
     ggcggtctga cgcgcagcat ggggtatgac gctgccgggc gcatcactgt gctgaccaac      1980
     gagaacggca gccagtccac gttccggtat gacccggtcg acaggctgac tgaacagcgc      2040
     ggttttgacg gccggacgca acgttaccac tatgacctga ccagaaaact cacacagagt      2100
     gaagacgagg ggcttatcac cctctggcac tacgatgcgt cggaccgcat cacgcaccgg      2160
     acggtgaacg gcgacccggc agagcagtgg cagtatgatg agcacgggtg gttaaccacc      2220
     ctcagccata ccagtgaagg ccaccgcgtg tcggtccact acggctacga cgataagggc      2280
     cgcctgacgg gcgaacggca gacggtggag aacccggaga cgggggaact gctgtggcag      2340
     catgagacga aacacgccta caacgaacag gggctggcaa accgcgtcac gccggacagc      2400
     ctgccgccgg tggagtggct gacctacggc agcggttacc tggcgggcat gaagctgggc      2460
     gggacgccgc tggtcgagta tacgcgggac aggctgcacc gtgagacggt gcgcagcttc      2520
     ggcagcaggg caggcagtaa tgccgcatac gaactgacca gcacatacac ccccgcaggc      2580
     cagttacaga gccagcacct gaacagcctg gtatatgacc gtgactacgg gtggaatgac      2640
     aacggcgacc tggtgcgcat cagcggtccg cgacagacgc gggaatacgg ctacagcgcc      2700
     acgggcaggc tggagagcgt gcgcaccctc gcaccggacc tggacatccg catcccgtat      2760
     gccaccgacc cggcgggaaa ccgcctgccg gacccggagc tacacccgga cagcacgctc      2820
     acggcgtggc cggataaccg catcgcagag gatgcgcact atgtttacca ctatgatgaa      2880
     tacggcagac tgacggagaa gacggaccgt atcccgacgg gtgtgatacg gacggacgac      2940
     gagcggaccc accactacca ctacgacagc cagcaccgcc tggtgttcca cacgcggata      3000
     cagcatggcg agccactggt cgagagccgc tacctctacg acccgctggg acggcgaatg      3060
     gcgaaacggg tatggcggcg ggagcgtgac ctgacggggt ggatgtcgct gtcgcgtaaa      3120
     ccggaggaga catggtacgg ctgggacggc gacaggctga cgacggtaca gaccgacacc      3180
     acgcgtatcc agacggtata ccagccgggg agcttcacgc cgctcatccg ggtcgagaca      3240
     gagaacggcg agcgggagaa agcgcagcgc cgcagcctgg cggagaagtt acagcaggaa      3300
     gggagcgaag acggtcacgg tgtggtgttc ccggctgaac tggtggggct gctggacagg      3360
     ctggaggggg aaatccgggc aaactgcgtg agcagtgaaa gccgccagtg gcttgcgcag      3420
     tgcgggctga cggtggagcg gctggcggca cagatagagc cggtttattt gcctgagcga      3480
     aaaatacatc tttatcactg tgaccaccgg ggcctgccgc tggcgcttat cagtgaagac      3540
     ggcaatacgg cgtggagcgc ggaatatgat gaatggggca accagcttaa tgaggagaac      3600
     ccgcatcacc tgcaccagcc gtaccggctg ccggggcagc agtatgataa ggagtcgggg      3660
     ctgtactata accgtcaccg gtactacgat ccgttgcagg ggcggtatat caccccggac      3720
     ccgattgggt tgagaggtgg atggaatatg tatcagtatc cgttgaatcc catacaagtg      3780
     atagacccaa tggggttaga tgcgattgag aatatgacat caggtggact aatttatgcc      3840
     gtatctggtg tacctggatt gattgctgca aacagcatta ctaacagtgc ttaccagttc      3900
     ggttatgata tggatgctat tgttggcgga gctcataatg gggccgccga tgcaatgaga      3960
     cattgttact tgatgtgtcg aatgactaag acatttggat caacaatagc tgacgtgata      4020
     ggtaaaaatc atgaggcggc aggggataga caaggtcagc cagctaaaga aagaatcatg      4080
     gatcttaaaa ataacactgt cggtattgct tgtggcgatt tttctgccaa atgtagcgat      4140
     gcatgtattg aaaaatataa cactgggcaa ctcttcgggt tagatggtat aaaagcagat      4200
     aatccaataa aagcaaagca agggagttca gatgcttcaa attattag                   4248
//

If you have problems or comments...

PBIL Back to PBIL home page