(data stored in ACNUC10821 zone)

EMBL: AP010958.PE232

AP010958.PE232       Location/Qualifiers
FT   CDS_pept        268189..268671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0232"
FT                   /product="conserved predicted protein"
FT                   /note="fused ECs0243/ECs0244, similar to ECs0243
FT                   (N-terminal part), 92.9% identity in 56 aa overlap, similar
FT                   to ECs0244 (C-terminal part), 97.7% identity in 87 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0232"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29108"
FT                   /db_xref="GOA:C8U1V0"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1V0"
FT                   /protein_id="BAI29108.1"
FT                   /translation="MLQIIRGKLVIFLITLCLFVVYLGFDNNSNSDIVFYGHKTPKSVE
FT                   IYLSEKNIIYKIINDQKISRGNGHFISIMVNNYRTHCGVVDINLNFFNDILYSVRLKNI
FT                   SKLENMEFCAKKQRVYFSDKNKKASYKIINYGDYYDVDYYDNNLKNEVFDWIGKWS"
     atgcttcaaa ttattagagg caaacttgtc atttttttaa ttaccctttg tttatttgtt        60
     gtttaccttg ggtttgataa caattcaaat tctgacatcg tattttatgg acataaaaca       120
     ccaaagagcg ttgagatata tctttctgaa aaaaatatta tttataaaat aattaatgac       180
     caaaaaatta gtagagggaa tggtcatttt ataagtataa tggttaataa ttacaggacg       240
     cactgtggag tggttgatat aaatcttaat tttttcaatg atattcttta tagcgtgcga       300
     ttaaaaaaca ttagtaaact ggagaatatg gagttctgcg ctaaaaaaca acgggtgtat       360
     tttagtgata aaaacaagaa ggctagttat aaaataatta attatggaga ctattacgat       420
     gttgattatt atgataacaa tttgaaaaat gaagtttttg actggattgg taaatggtca       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page