(data stored in ACNUC10821 zone)

EMBL: AP010958.PE250

AP010958.PE250       Location/Qualifiers
FT   CDS_pept        284559..285698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0250"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29124"
FT                   /db_xref="GOA:C8U1W6"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR017510"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1W6"
FT                   /protein_id="BAI29124.1"
FT                   /translation="MGNYIRPLSDAVFTIASDDLWIESLAIQQLHTTANLPNMQRVVGM
FT                   PDLHPGRGYPIGAAFFSVGRFYPALVGNDIGCGMALWQTDILARKYNADKFEKRLSDLD
FT                   DVAEESWLEENLPSAFAQHPWRSSLGSIGGGNHFAELQQVDQIINAELFALAGLDAQHL
FT                   QLLVHSGSRGVGQSILQRHIASFSHHGLPQGSDDALRYIAEHDDALAFACINRQMIALR
FT                   IMQQVKATGSPVLDVAHNFVSACQIGDQQGWLHRKGATPDDNGLVIIPGSRGDYSWIVQ
FT                   PVANEKTLHSLAHGAGRKWGRTECKGRLAAKYTATQLSRTELGSRVICRDKQLIFEEAP
FT                   QAYKSAESVVQCLVQAGLIIPVARLRPVLTLKNSGGKKG"
     atgggcaatt atattcgtcc cttatccgat gcggtattta ccatcgcatc tgatgacctg        60
     tggatcgaga gtttagcgat ccaacaatta cacaccacgg caaatttacc caacatgcag       120
     cgcgtagtgg ggatgccaga tttacatccc ggacgcggct atccgattgg cgcagcgttc       180
     ttctctgttg gtcgttttta tccggcactg gtcggcaatg atatcggctg cggtatggcg       240
     ctatggcaaa cagatattct cgctcgcaaa tacaacgccg ataagtttga aaagcgatta       300
     tcagatctgg atgacgttgc tgaagaaagc tggctggagg aaaacctgcc gtcagcattt       360
     gcacagcatc cgtggcgcag ctcgcttggc tctatcggtg gcggcaatca tttcgctgaa       420
     ctgcaacaag ttgatcaaat catcaacgct gaactgtttg cactggcagg tctggatgca       480
     caacatctgc aactgttggt tcatagcggc tcgcgggggg tggggcagtc tattttacag       540
     cggcatattg cctcgttctc gcatcatggt ttgcctcaag gcagtgacga cgcgctacgg       600
     tatattgcgg aacatgacga tgcgctggcg tttgcgtgta ttaatcgcca gatgatcgct       660
     ttgcgcataa tgcaacaagt taaggccacg ggaagtccgg ttctggatgt ggcgcataac       720
     tttgttagcg cgtgtcaaat cggcgatcaa cagggctggt tgcatcgtaa aggtgccacg       780
     ccggatgaca acggtctggt gattattccc ggttcacgtg gtgattactc ctggattgta       840
     cagcctgttg cgaacgaaaa aacgctccac tcgctggcgc atggggcagg gcgtaaatgg       900
     gggcgcaccg agtgtaaagg gcgtctggca gcgaaataca cggcgacgca actctcgcgt       960
     actgaacttg gcagtcgggt aatttgtcgc gataaacaac tcatctttga agaagcgcca      1020
     caagcctata aatcggctga aagcgtggtg caatgtctgg tgcaggccgg tttaattatt      1080
     cctgtcgcgc ggctgcgtcc ggtgctaacg ctcaaaaaca gtggagggaa aaaaggatga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page