(data stored in ACNUC10821 zone)

EMBL: AP010958.PE292

AP010958.PE292       Location/Qualifiers
FT   CDS_pept        332234..336217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0292"
FT                   /product="AidA-I adhesin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0292"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29163"
FT                   /db_xref="GOA:C8U205"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:C8U205"
FT                   /protein_id="BAI29163.1"
FT                   /translation="MNKIYRLKWNRSRNCWSVCSELGSRVKGKKSRAVLISAISLYSSL
FT                   VFADDVIVNQDKAIDFGKENQSIDYRITVTDNANLVINTTDTSRPRLTLASGGGLDITG
FT                   GKVTINGPLNFLLKGTGFLNVSNAGSELYADDLYESNSGMRHDQGYFNVSNGGKIHVKG
FT                   TSRLTYTQGNVSGEGSQVNAGTFFMGVYGGYGGNQFLSVNNGGEVNAREHISLGYYDQR
FT                   SDTTLVVSDGGKISAPKISLSTNSELALGAQEGSAAKAAGIIDAEKIEFVWAKTSDKKI
FT                   TLNHTDKNATISADIVSGSEGLGYINALNGTTYLTGDNSAFSGKVKIEQNGALGITKNI
FT                   GTAEINNRGKLHLKADDSMTFANKISGNGTISIDSGTVALTGNNYAFSGYIDVASGAVA
FT                   VISEDKNIGRADLDVDGKLQINANKDWVFDNDLQGRGIVEINMGNHEFSFDEFAYTDWF
FT                   QGSLAFQNTTFNLEKNAEFLQRGGITAGQGSLVTVGKGAHSISTLGFSGGTVDFGALTA
FT                   GAQMTEGTVNVSKTLDLRGEGVIQVSDSDVVSSVSRDIDSALSLTEVDDGNSTIKLVDA
FT                   QGAEVLGDAGNLQLQDKNGQILSSSAQRDIQQNGQKAAVGTYDYRLTSGVNNDGLYIGY
FT                   GLTQLDLHATDSDALVLSSNGKSENAADLSAKITGSGDLAFSSQKDQTVSLSNKDNDYT
FT                   GVTDLRSGTLLLNNDNVLGNTHELRLAAETELDMNGHSQTVGTLNGSADSLLSLNGGSL
FT                   TVTNGGTSTGSLTGSGELNIQGGTLDIAGDNSNLTANVNIANSANVLVSHAQGLGSANV
FT                   ENNGTLALNNSAEKRAAASVNYTLGGNLTNNGTLMTGMSGQQAGNVLVVKGNYHGNNGQ
FT                   LVMNTVLNGDDSVTDKLVVEGDTSGTTAVTVNNAGGTGAKTLNGIELIHVDGKSEGEFV
FT                   QAGRIVAGAYDYTLARGQGANRGNWYLTSGSDSPELQPEPDPMPNPEPNPNPEPNPNPT
FT                   PTPGPDLNVDNDLRPEAGSYIANLAAANTMFTTRLHERLGNTYYTDMVTGEQKQTTMWM
FT                   RHEGGHNKWRDGSGQLKTQSNRYVLQLGGDVAQWSQNGSDSWHVGVMAGYGNSDSKTIS
FT                   SRTGYRAKASVNGYSTGLYATWYADDESRNGAYLDSWAQYSWFDNTVKGDDLQSESYKS
FT                   KGFTASLEAGYKHKLAEFNGNQGTRNEWYVQPQAQVTWMGVKADKHRESNGTLVHSNGD
FT                   GNVQTRLGVKTWLKSHHKMDDGKSREFQPFVEVNWLHNSKDFSTSMDGVSVTQDGARNI
FT                   AEIKTGVEGQLNANLNVWGNVGVQVADRGYNDTSAMVGIKWQF"
     atgaataaaa tatatcggct aaagtggaac aggtcccgta actgttggag cgtctgctcg        60
     gagctgggga gcagagtaaa aggaaaaaag tcccgggctg ttttaattag cgcgataagt       120
     ttatattcat ctctggtatt cgccgatgat gtcatcgtaa accaggataa agctattgat       180
     tttggcaaag agaaccagag catcgattac cgtattacgg tgactgacaa tgccaatctg       240
     gtaatcaata cgacagatac ttcccgtccg cgtctgactc tcgcttctgg tggtgggttg       300
     gatattaccg gaggaaaggt aacaatcaat ggcccgctta actttttgct gaaaggtacg       360
     gggttcctga atgtctccaa tgctggcagc gagttatatg ctgatgattt gtatgagtca       420
     aactcaggca tgagacatga tcaaggctat tttaatgtct ccaatggcgg caaaattcat       480
     gttaagggca ccagtcgtct gacttatacg caggggaatg taagcggcga aggtagtcag       540
     gtaaatgcag ggaccttctt tatgggcgtt tacggcggat atggcggtaa tcagttcctg       600
     tcggttaata acggtggtga agttaatgct cgtgaacata ttagcctggg ttattacgac       660
     caacgttctg atacaacatt agtcgtatca gatggaggta aaatatccgc accgaaaatt       720
     agtttaagca ccaactctga gttagcgtta ggtgcacagg aaggaagtgc tgcgaaggct       780
     gcagggatta ttgatgccga aaaaattgag tttgtgtggg caaagacatc cgataagaaa       840
     atcaccttaa accacacgga taaaaacgcg actatttccg cggatattgt cagtggcagc       900
     gagggcctgg gctatatcaa tgcgctcaat ggcacgactt acttaaccgg tgataactct       960
     gcctttagtg gtaaagtcaa aattgagcaa aatggcgctt tagggatcac caaaaatata      1020
     ggtacagcag agatcaacaa ccgcgggaaa ttacacctga aggctgacga tagcatgacc      1080
     tttgccaata agatttccgg caatggtaca ataagtatcg acagtgggac agtggcactg      1140
     accggcaata actatgcatt cagcggatat attgatgtcg cttctggtgc tgtcgcggtt      1200
     atttctgaag acaagaacat cggccgtgcg gacctggatg ttgatggcaa actgcaaatc      1260
     aatgccaata aagattgggt atttgataac gatcttcaag gtagaggtat tgttgaaata      1320
     aacatgggga atcacgaatt ctccttcgat gagtttgctt atacagactg gttccagggt      1380
     tcactggcgt tccagaacac gacatttaac ctggaaaaga atgctgagtt tctgcagaga      1440
     ggcgggatca ctgcgggtca gggaagcctg gtaacagtgg gtaagggcgc tcactccatt      1500
     agcactttgg gattctccgg cggaaccgtt gattttggtg ccctgacagc aggtgcacag      1560
     atgacagaag ggacggtcaa cgttagtaaa acgctggatt tgcgcggcga gggtgtgatt      1620
     caggtttctg acagtgacgt tgtaagctca gtatctcgtg atattgactc tgcgttatcg      1680
     ctcactgaag tcgatgatgg taacagcacc attaagttgg ttgatgcgca aggtgcggaa      1740
     gttctgggcg atgcgggcaa tctgcaattg caggataaaa atgggcaaat cctctccagc      1800
     agtgcccaac gtgatattca gcagaatggg caaaaagcgg ccgtcggcac ttacgactat      1860
     cgtctgacga gtggggtaaa caatgacggt ctgtatatcg gttacggcct gacccagctt      1920
     gatttacacg ctaccgatag cgatgctctg gtgctgagct ctaacggtaa aagcgagaat      1980
     gccgccgatc tcagcgcaaa gattaccggc agcggtgacc tggcattcag cagccagaag      2040
     gatcagaccg tatcgctttc taacaaagac aacgactata ccggtgttac cgatctgcgc      2100
     agtgggacgc ttttgttgaa taacgataac gtgttgggta atacccatga actgcgtctg      2160
     gcggcagaga ctgaactgga tatgaatggt cacagccaga ccgtgggcac gctcaatggc      2220
     agcgccgatt cactgctgag cttaaatggc ggcagtctga cggttaccaa cgggggcact      2280
     tcaaccggtt cgttaacggg gagcggagag ctgaatattc agggcggcac gctggacatc      2340
     gcgggcgata acagcaacct gacggcgaat gtgaacattg ctaattcggc taatgtcctg      2400
     gtaagtcatg cgcagggatt gggtagcgca aacgttgaga acaacggtac cctggcgttg      2460
     aataatagcg ctgaaaaaag agcggctgcg tctgtgaatt acaccctggg cggcaatctg      2520
     accaacaacg gtacgctgat gaccggaatg tcaggacagc aagctggcaa tgtgttagtg      2580
     gtgaagggga actaccacgg taataacggt caactagtaa tgaatacggt actgaatggc      2640
     gatgactcag taaccgataa attggttgtc gagggcgata ctagcggcac gactgccgtt      2700
     acggtgaata acgctggcgg tacaggtgcg aaaaccctta acggtatcga acttatccat      2760
     gtagacggta agtctgaggg cgaatttgtt caggctggtc gtatcgttgc gggggcgtat      2820
     gactacactc tcgcgcgtgg acaaggggca aatcgtggta actggtatct gaccagcggc      2880
     agtgattctc ctgaactgca gccggagcca gacccgatgc cgaatccgga gccaaacccg      2940
     aatccagagc cgaaccctaa cccgacacct acgccgggtc cggatctgaa tgtggataat      3000
     gacctgcgac cggaggcggg tagctacatt gcgaaccttg cagcagcgaa tacaatgttc      3060
     accacgcgtc tgcatgagcg tctgggtaat acgtactata ccgacatggt gacgggtgag      3120
     cagaaacaaa ccactatgtg gatgcgccat gaaggtggtc ataataaatg gcgtgatggc      3180
     agcggccagc tgaaaaccca aagcaatcgc tatgttctgc aactgggagg cgatgtcgcg      3240
     cagtggagcc aaaacggcag cgacagctgg catgttgggg tcatggcggg atatggcaac      3300
     agcgacagca aaaccatttc ctcgcgaacc ggttatcgtg caaaagcgag tgtgaacgga      3360
     tatagcaccg gcctctatgc cacctggtat gccgatgacg agtcgcgtaa tggcgcgtat      3420
     ctcgacagtt gggcgcagta cagctggttt gataacacag tgaaagggga tgacttacaa      3480
     agtgaatcct ataaatcaaa aggatttacc gcttcactgg aagctggata caaacacaaa      3540
     ttagctgaat ttaatggcaa ccagggaacg cgtaatgaat ggtatgttca gccgcaagca      3600
     caggttacct ggatgggagt caaagccgat aagcaccgcg aaagcaacgg aaccctcgtt      3660
     catagcaacg gtgatggcaa tgttcaaacc cgacttggcg taaaaacctg gctgaagagc      3720
     caccataaaa tggatgacgg taaatcccgc gagttccagc cgtttgtaga agtgaactgg      3780
     ctgcataaca gtaaggattt cagcaccagt atggatggcg tgtccgtcac tcaggatgga      3840
     gcccgaaata ttgctgagat aaaaaccggg gtggaaggac agctaaatgc caacctgaat      3900
     gtctggggga atgtgggcgt tcaggttgcc gataggggat ataatgacac ctctgcaatg      3960
     gttggcatta agtggcaatt ctga                                             3984
//

If you have problems or comments...

PBIL Back to PBIL home page