(data stored in ACNUC10821 zone)

EMBL: AP010958.PE302

AP010958.PE302       Location/Qualifiers
FT   CDS_pept        346485..346925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0302"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29172"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:C8U214"
FT                   /protein_id="BAI29172.1"
FT                   /translation="MFFRNRKNIAMTIKEKFSQKYPHASFCTFGDSAALADHLATLIAT
FT                   GVKTASCGSLAGCIEDNAFPMIGEYKIVENSRGEPVCVIRVIGLHLLRFSDVTVELARK
FT                   EGEGDLSLEYWRNEHRRFFQAEGSYSPEMDVIFEEYALIDVV"
     ttgtttttcc gtaatcgcaa aaatattgcc atgaccataa aagaaaaatt ctcacaaaaa        60
     tatccccatg cttccttttg tacttttggc gattcagcag cgttggccga tcacctcgca       120
     acgttgattg cgactggtgt taaaacagct tcctgtggtt cgctggcggg atgtattgaa       180
     gacaacgcat ttccgatgat tggtgagtat aagattgtag aaaatagccg tggtgagcct       240
     gtatgtgtta tcagagtgat tggcctgcat ttactgcgct tttctgatgt caccgtggag       300
     cttgcccgta aggaaggtga aggtgacctc agtcttgaat attggcgtaa tgaacaccgt       360
     cgttttttcc aggcagaagg aagctattca ccagaaatgg acgttatatt tgaagaatat       420
     gcccttattg acgttgtgta g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page