(data stored in SCRATCH zone)

EMBL: AP010958.PE35

AP010958.PE35        Location/Qualifiers
FT   CDS_pept        complement(37236..37454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0035"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28915"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1A7"
FT                   /protein_id="BAI28915.1"
FT                   /translation="MTRFEAIKQGHIKIVDISIVCNFTVDKCELNPAYVIKNIDSPKDL
FT                   LNGQKKRSSSENRITYSIKLADEKYPP"
     atgactcgtt ttgaagcaat taaacaaggc catattaaaa ttgtggatat atcgatagta        60
     tgcaacttca ccgtcgataa gtgtgagcta aatcctgctt atgtcatcaa aaatatcgat       120
     tccccaaaag atttacttaa tgggcaaaaa aaacggtcct catcagagaa ccgtattact       180
     tattcgatca aattagcgga tgaaaaatat ccgccatga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page