(data stored in ACNUC10821 zone)

EMBL: AP010958.PE404

AP010958.PE404       Location/Qualifiers
FT   CDS_pept        complement(454907..455218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0404"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29272"
FT                   /db_xref="GOA:C8U2B4"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2B4"
FT                   /protein_id="BAI29272.1"
FT                   /translation="MPGKTATLPDVDKTLKNARVELKTSPDAKNKLREAAQAVGVDLSA
FT                   FILSAAMERAESVLDNQRRRELSNQSWELMNQLIAEPAQPTLALKALMKRKNSDGRQA"
     atgcctggaa aaacagccac tctacccgat gtcgataaaa cgctgaaaaa tgcgcgggtc        60
     gaactcaaaa ctagtcccga cgccaaaaac aaacttcgtg aagctgcgca agccgttggg       120
     gtagatttaa gcgcttttat tttgagcgct gctatggaac gcgccgaaag tgtgcttgat       180
     aaccaacgtc gccgtgagct ttcgaatcaa agctgggaac tgatgaacca actcatcgct       240
     gaacctgctc aaccgacgct cgccctcaag gcgttaatga aaaggaaaaa cagcgatggt       300
     cgacaagcat ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page