(data stored in ACNUC10821 zone)

EMBL: AP010958.PE510

AP010958.PE510       Location/Qualifiers
FT   CDS_pept        complement(573357..573662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0510"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29377"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2L9"
FT                   /protein_id="BAI29377.1"
FT                   /translation="MTTFTNKELIKEIKERISSLEVRDDIERRAYEIALVSLEVEPDER
FT                   EAYELFMEKRFGDLVDRRRAKNGDNEYMAWDMTLGWIVWQQRAGIHFSTMSQQEVK"
     atgaccacat ttaccaataa agaactgatt aaagaaatca aagaacgaat cagcagccta        60
     gaggttcgag acgatattga gcgccgtgct tatgaaatcg cactcgtatc tctggaagta       120
     gagccagatg aacgcgaagc ctatgaatta ttcatggaaa agcgtttcgg tgacttagta       180
     gatcgtcgga gagcaaaaaa cggcgataac gaatacatgg catgggatat gactctcggt       240
     tggatcgtct ggcagcaacg agctggtatc catttttcaa caatgtcaca gcaagaggtg       300
     aaataa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page