(data stored in ACNUC10821 zone)

EMBL: AP010958.PE511

AP010958.PE511       Location/Qualifiers
FT   CDS_pept        complement(573662..574024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0511"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0511"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29378"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2M0"
FT                   /protein_id="BAI29378.1"
FT                   /translation="MRMNVFEMEGFLRGKCVPRDLKVNETNAEYLLRKFDALEAKCAAL
FT                   ENKIIPVSAELPPANESVLLFDANGEGWLIGWRSLWYTWGQKETGEWQWTFQVGDLENV
FT                   NITHWAVMPKAPEAGA"
     atgcgcatga atgttttcga aatggaaggg tttcttcgcg ggaaatgtgt accgcgagat        60
     ctgaaagtga acgaaacaaa tgctgagtac ctgttacgta aattcgacgc gcttgaagct       120
     aaatgtgcgg cactggaaaa caaaataata ccagtgtcag ctgaactgcc accagcaaat       180
     gaaagtgttc tgttatttga tgctaatgga gaaggctggc tgattggctg gcgttctctc       240
     tggtacacct ggggacaaaa agaaaccgga gaatggcagt ggacatttca ggtcggggac       300
     cttgaaaacg tcaatatcac tcactgggca gtaatgccaa aagcaccgga ggctggagca       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page