(data stored in ACNUC10821 zone)

EMBL: AP010958.PE515

AP010958.PE515       Location/Qualifiers
FT   CDS_pept        576189..576917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0515"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0515"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29382"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2M4"
FT                   /protein_id="BAI29382.1"
FT                   /translation="MGIHRRSTVSLNLNPRALSRIHHNAKDSLWLKILSCYVPAFSHIR
FT                   RGGPGYSPTTRIRLIWISPTTIRVFNVIAELTAAMTAIRETAQIAKLMNEAKTQAEVNA
FT                   AIGELNSKLASIQRECVSLVELVGSYQEINASLKAKIAEFENFEAQTEGYILNQLESGT
FT                   FVYSKEVIVNGGSITMHLCPKCFGQKIVSILQPFPVSEDELFHKSRCLHCENKFLMNKN
FT                   PDYVSPPSIEELSRKLNGNL"
     gtgggtatcc acagaaggtc gactgtcagc ctcaacctta acccgcgtgc gctgagccgc        60
     attcaccaca acgctaagga ttctctctgg ttgaaaatac ttagctgtta tgtgcctgct       120
     tttagccaca tcaggcgagg tggacctggt tattccccaa caacaaggat tcggttaatc       180
     tggatatccc caacaacaat aagagtattc aatgtgatcg ctgaattaac ggcagcaatg       240
     acggctattc gtgaaacagc ccagattgca aaactaatga acgaggcaaa aactcaagct       300
     gaagtaaatg cggctattgg tgagctgaac tcaaagcttg cgtctattca gcgcgaatgc       360
     gtgtctctcg ttgaactggt gggctcttat caagaaataa atgcttctct caaagctaaa       420
     attgcagaat tcgaaaactt tgaggctcag acggaaggct atatccttaa ccaacttgag       480
     tcgggtactt ttgtatactc gaaggaggta atcgtgaacg gtggcagcat aaccatgcat       540
     ctttgcccaa aatgttttgg acaaaagata gtatcgatac ttcaaccatt cccggttagc       600
     gaagatgagc tttttcataa aagcaggtgc ctccactgtg aaaataagtt tctgatgaat       660
     aaaaatccgg attacgtatc gcctccatcc attgaggagt tgtccagaaa acttaacggc       720
     aatctgtag                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page