(data stored in SCRATCH zone)

EMBL: AP010958.PE516

AP010958.PE516       Location/Qualifiers
FT   CDS_pept        complement(577237..577884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0516"
FT                   /product="probable phage repressor protein CI"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0516"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29383"
FT                   /db_xref="GOA:C8U2M5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2M5"
FT                   /protein_id="BAI29383.1"
FT                   /translation="MKIADLAEAIGVDAANISRLETGKQKQFTEQTLSNIAKSLGVDIA
FT                   DLFTSAHKSNAVYKNSNNEDVAQVKDVFRIEMLDISASAGNGLIQGGDVIDVIHAIEYR
FT                   TDNAVSMFGGRPANHIKVINVRGDSMCPTIEPGDLIFVDVSINQFDGDGIYVFGFDDKI
FT                   YVKRLQMIPDKLLVISDNQIYREWGITSENEHRFMVFGKVLISQSQTLKRHN"
     atgaaaatcg ccgatctcgc tgaagcgata ggagtagatg cggcgaacat ctcgcgctta        60
     gaaacgggta agcaaaaaca atttaccgaa caaacactga gtaatattgc caagagctta       120
     ggtgttgata ttgctgatct ctttacctct gcccacaaaa gtaatgctgt atataaaaac       180
     agtaataatg aggatgttgc gcaggtgaag gatgtgttcc gtattgaaat gctggatatc       240
     agtgccagtg cgggaaatgg ccttatccag ggcggtgatg tcattgatgt gattcatgcc       300
     atcgaataca gaactgataa tgctgtatca atgttcggcg gacgaccagc caatcacatc       360
     aaagttatca acgttcgtgg ggacagtatg tgtccaacca ttgagccagg agatctcatc       420
     ttcgttgatg tcagcatcaa tcagtttgat ggtgatggta tatatgtctt tggttttgat       480
     gacaaaatat acgttaaaag acttcaaatg attcctgaca aactgctggt gatttctgat       540
     aaccagattt accgtgaatg gggaattact agcgaaaacg aacaccgatt catggtcttt       600
     ggaaaggtct taatcagtca gtcgcaaacc cttaagagac ataattaa                    648
//

If you have problems or comments...

PBIL Back to PBIL home page