(data stored in SCRATCH zone)

EMBL: AP010958.PE518

AP010958.PE518       Location/Qualifiers
FT   CDS_pept        578280..578831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0518"
FT                   /product="putative phage regulatory protein CII"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0518"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29385"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2M7"
FT                   /protein_id="BAI29385.1"
FT                   /translation="MGKHHWKVEKQPEWYVKAVRKTIAALPGGYAEAADWLDVTENALF
FT                   NRLRADGDQIFPLGWAMILQRAGGTHFIADAVAQSANGVFVSLPDVEDVDNADINQRLL
FT                   EVIEQIGSYSKQIRSAIEDGVVEPHEKTAINDELYLSISKLQEHAALVYKIFCISESND
FT                   ARECAAPGAVACRDCGETNA"
     gtgggtaagc atcactggaa agtagaaaaa cagcctgagt ggtacgtgaa agctgtcaga        60
     aaaactatcg cagcgttgcc gggggggtac gctgaagctg ctgactggct ggatgtaaca       120
     gagaacgcat tatttaaccg ccttcgtgcc gatggcgatc agattttccc gctgggatgg       180
     gcaatgattt tgcaacgtgc tggtggaact cacttcattg ctgacgctgt ggcgcagtct       240
     gcaaatggcg tctttgtgtc tcttcctgat gtcgaggatg tggacaacgc cgatatcaac       300
     caacgcctgc tggaggtcat tgaacagatc ggcagttatt caaaacagat tcgttcagca       360
     attgaagacg gtgtagtgga accgcatgag aagacagcaa ttaacgacga gctgtacctc       420
     tcaatttcga agctgcagga gcatgcagca ctggtctaca aaattttttg catttcagaa       480
     agtaatgacg cccgcgagtg tgcagctccg ggcgccgtgg cgtgtcgtga ctgtggagaa       540
     actaacgcat ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page