(data stored in ACNUC10821 zone)

EMBL: AP010958.PE519

AP010958.PE519       Location/Qualifiers
FT   CDS_pept        578828..579166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0519"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0519"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29386"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2M8"
FT                   /protein_id="BAI29386.1"
FT                   /translation="MNSLTTHYRRSQLIALPVPGGKAKVEYCYAVNVPGGRVIVTHSFA
FT                   EWAVGDFNRQKETVLCDKLTAGSKITTEYPSESFVGSRKHNELSTSAKAMSMSASARSN
FT                   SFVVNSGK"
     atgaacagtt taacaacaca ctaccgtcgc tcgcaactga ttgcgcttcc tgtaccgggt        60
     ggaaaagcga aggtggagta ttgctatgca gttaatgtac caggtggcag ggtaattgta       120
     acccacagct ttgcagagtg ggctgtgggt gattttaacc ggcagaagga gacagtcctt       180
     tgcgacaagt taaccgctgg ttcaaagatc actacggagt acccgtcaga gtcattcgtt       240
     gggagccgga aacacaacga gttatctacc tccgcgaagg ctatgagcat gagtgcttca       300
     gcccgctcga acagtttcgt cgtaaattca gggaaatag                              339
//

If you have problems or comments...

PBIL Back to PBIL home page