(data stored in ACNUC10821 zone)

EMBL: AP010958.PE520

AP010958.PE520       Location/Qualifiers
FT   CDS_pept        579176..580117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0520"
FT                   /product="probable replication protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29387"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2M9"
FT                   /protein_id="BAI29387.1"
FT                   /translation="MSTKLTGYVWDGCAASGMKLSSVAIMARLADFSNDEGVCWPSIET
FT                   IARQIGAGMSTVRTAIARLEAEGWLTRKARRQGNRNASNVYQLNVAKLQAAAFSQLSDS
FT                   DPSKSDASKSDPSKFDASKSGKKAGFHPSESGGDPSVKSKHDPSDKKPSRPDASQPDTQ
FT                   TDEQDFLTRHPDAVVFSPKKRQWGTQDDLTCAQWLWKKIIALYEQAAECDGEVVRPKEP
FT                   NWTAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSP
FT                   SVSTYTEKREDPYFKSSYDNVDYSQIPAGFRG"
     atgagcacta aattaaccgg ctatgtatgg gatggttgcg ctgcatcagg catgaaatta        60
     tccagcgtgg caattatggc ccgcctggct gatttcagta atgacgaagg tgtgtgctgg       120
     ccatcaattg aaactattgc ccgtcagatt ggcgcgggga tgagtaccgt caggacggct       180
     atcgcacggc tggaagcaga aggctggtta acgcgtaagg cgcgtcgcca gggtaaccgc       240
     aatgcgtcga atgtttatca gcttaacgtt gcgaagcttc aggcagcggc attttctcaa       300
     ctgtcagatt ctgacccgtc aaaatctgac gcatcaaaat ctgacccgtc aaaatttgat       360
     gcgtcgaaat ctggcaaaaa agcgggtttt cacccgtcag aatctggcgg ggatccgtca       420
     gtaaaatcaa aacatgatcc gtcagataaa aaaccttctc gtccggacgc ttcgcaaccg       480
     gacacgcaga cggatgaaca ggatttttta actcgccatc ctgatgcggt tgtattcagc       540
     cctaaaaagc gccagtgggg aacgcaggat gatttgacct gcgcacagtg gctctggaaa       600
     aaaatcatcg ccctgtacga gcaagccgcc gaatgtgacg gcgaggtggt tcgtcccaaa       660
     gaaccgaact ggacagcctg ggcaaacgaa attcgcctga tgtgtgtgca ggatggtcgt       720
     actcacaaac aaatctgcga gatgtacagc cgcgtcagcc gcgatccgtt ctggtgccgt       780
     aacgtgctca gcccgtcgaa gttgcgggaa aaatgggatg agctttccct gcgcttatca       840
     ccgtccgtca gcacgtacac cgaaaaacgc gaagacccgt acttcaaatc cagttacgac       900
     aacgtggact acagccagat cccggcagga ttcagggggt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page