(data stored in ACNUC10821 zone)

EMBL: AP010958.PE521

AP010958.PE521       Location/Qualifiers
FT   CDS_pept        580120..580608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0521"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0521"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29388"
FT                   /db_xref="InterPro:IPR024684"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2N0"
FT                   /protein_id="BAI29388.1"
FT                   /translation="MSLLNEVQKFIEAHPGCTSGDIADAFAGYSRQRVLQSASKLRQSG
FT                   RVAHRCEGDTRRHFPRLTERAQEPEPQPVRETRPVRNFYVGTNDPRVILCLTRQAEELE
FT                   SRGLYRRAATVWMAAFRESHSQPERNNFLARRERCLRKSSKRAASGEEWYLSGNYVGA"
     atgagtcttt tgaatgaagt tcagaaattc attgaagccc atccgggatg tacttccgga        60
     gacattgcgg atgcttttgc aggttactca cggcagcgcg ttctgcagtc agcaagcaag       120
     ttacgtcaga gtgggcgtgt ggctcaccgt tgtgaaggag atacacgcag acatttcccg       180
     cgcctgactg agagagcgca ggaaccggaa ccacaaccag ttcgagaaac cagacctgtg       240
     cgcaatttct atgtcggcac taacgatcca cgggtgattt tgtgcctgac ccgccaggct       300
     gaagaactgg agtccagggg cttataccgt cgtgctgcaa cggtgtggat ggcggcattc       360
     cgtgaaagcc actcccagcc agaacgaaac aattttctgg cgcgtcgtga gcggtgctta       420
     cggaaaagca gcaagcgcgc tgcatcgggt gaagagtggt atctgtcagg gaattacgtg       480
     ggggcttaa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page